SecReT6
Effector Protein ID: 261822692
-
SecReT6 ID369
T6SS typeA3
Gene symbol-
Locus tagPecwa_3454
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]3795317..3797284 [-]
ProductImpA family type VI secretion-associated protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDD0KKE8
KEGG IDpwa:Pecwa_3454
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.20E-69, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 4.00E-22, Aligned region: 367..459
Phage_base_V [PF04717], Evalue: 4.00E-22, Aligned region: 588..610
Gp5_C [PF06715], Evalue: 2.40E-06, Aligned region: 506..523
Gp5_C [PF06715], Evalue: 2.40E-06, Aligned region: 524..546
Gp5_C [PF06715], Evalue: 2.40E-06, Aligned region: 555..571
Protein Sequence: 655 a.a.     [Download]
>gi|261822692|ref|YP_003260798.1| ImpA family type VI secretion-associated protein [Pectobacterium wasabiae WPP163]
MANSTGLQFTVKVGALAAGTFAVVDFRLDEGLNRPFSLSLSLASVLPDVDFGAVLDQPCELMIWYEGELK
RRISGIISGFTQGDTGFRRTRYQAEVRPELWRLGLRTNARIFQAQKPDAIIGTLLEEAGITDYAFSLRHD
HAPREYCVQYRESDLAFVTRLAAEEGLYFFHEFEEGKHRVVFADDAGALAKGPELFFNLAAQGLSEGEYI
RRFHYAERVSTAEVELKDYSFKTPAYGLSHKKMSSELDHQRESYQHYDYPGRYKQDPSGKAFSNYRLDAL
RSGAVTSEGESNCAGLMPGNTFTLTEHPNATLNTVWQTVSVMHIGQQSQALEEESGGEPTTMSNSFAVIS
AKKNWRAVMPYKPMVDGPQIARVVGPAGEEIYCDKYGRIKLQFPWDRYGANNDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHATNPAPYPLPANKTRTTLRSKTHKGKGFNELSFEDATD
NEEIFLHAQKNMAVRVLNSKDERVDYNRTTSIGHDEALVVANDRKITVEGNQDHKITGNNLSLTEGDRGI
QVKGDLAQKISGVFSVDSNGDLTLQSGSKLTLRVGGSFVVIHAGGVDIKGPAINLNSGGSPGDLALPADP
AILKAAAAQGTMFVAHCPAKEKKGE
-
Nucleotide Sequence: 1968 bp     [Download]
>gi|261819370|ref|NC_013421.1|:c3797284-3795317 Pectobacterium wasabiae WPP163 chromosome, complete genome
GTGGCCAACAGTACAGGATTACAGTTCACCGTAAAGGTCGGCGCATTGGCGGCCGGCACCTTTGCGGTGG
TGGATTTCAGGCTGGATGAGGGGCTGAATCGGCCTTTCAGCCTGTCGCTGAGTCTGGCGAGCGTGTTGCC
GGATGTGGATTTTGGCGCGGTGCTGGACCAACCGTGCGAGCTGATGATTTGGTATGAGGGTGAGTTGAAA
CGCCGGATCAGTGGGATTATCAGTGGTTTCACACAGGGCGACACCGGTTTTCGCCGCACCCGCTATCAGG
CGGAAGTGCGTCCGGAGCTGTGGCGGTTGGGATTACGCACCAACGCCCGTATCTTTCAGGCCCAGAAGCC
GGACGCGATTATCGGTACTCTGCTGGAAGAAGCCGGCATTACCGACTACGCCTTTTCGTTACGTCATGAC
CATGCCCCGCGCGAGTACTGCGTTCAGTACCGGGAAAGCGATTTGGCGTTTGTCACCCGACTGGCGGCAG
AGGAAGGCTTGTACTTCTTCCACGAGTTTGAGGAAGGCAAACACCGTGTCGTCTTTGCCGACGATGCGGG
AGCGCTGGCTAAGGGCCCTGAGCTGTTCTTCAATTTGGCGGCGCAGGGGCTGAGCGAGGGGGAATACATC
CGGCGTTTCCACTATGCGGAGCGGGTGAGCACGGCAGAAGTGGAGTTGAAGGATTACAGCTTCAAGACAC
CGGCCTACGGGCTGTCACATAAGAAGATGAGTAGCGAATTGGATCACCAACGTGAAAGTTATCAGCATTA
CGACTATCCAGGACGTTATAAACAAGATCCGAGCGGCAAAGCGTTCAGCAACTACCGGCTGGATGCGCTG
CGCTCTGGAGCGGTGACGAGCGAAGGGGAATCGAACTGCGCAGGGCTGATGCCGGGCAACACGTTTACTC
TGACGGAACACCCGAATGCGACGCTGAATACGGTGTGGCAAACGGTGAGCGTGATGCATATCGGGCAGCA
GTCGCAGGCGCTGGAGGAGGAAAGCGGCGGTGAGCCGACGACCATGAGCAACAGCTTTGCGGTTATCAGT
GCGAAAAAAAACTGGCGGGCCGTCATGCCGTACAAACCGATGGTGGACGGCCCGCAGATTGCGAGGGTAG
TGGGGCCGGCTGGCGAAGAAATCTACTGCGACAAGTACGGGAGAATCAAACTGCAATTCCCGTGGGACCG
TTATGGGGCGAATAATGACCAGAGTTCCTGCTGGGTGCGTGTTAGCCAGGGCTGGGCGGGCGGCCAATAC
GGACTGATCGCTATCCCGCGTATCGGTCATGAAGTGATTGTTAGCTTCCTCGAAGGTGACCCGGATCAGC
CGATTGTCACTGGACGTACCTTCCACGCGACAAATCCAGCGCCGTATCCGCTGCCAGCCAATAAAACACG
TACCACGCTACGTTCAAAAACACACAAAGGAAAAGGCTTTAACGAACTCAGTTTTGAGGACGCGACCGAT
AACGAAGAGATCTTCCTTCATGCCCAGAAGAACATGGCAGTACGGGTACTGAATTCTAAAGATGAGCGAG
TGGACTATAACCGAACAACCAGTATTGGGCATGATGAGGCGCTGGTGGTCGCCAATGACCGTAAGATTAC
GGTGGAAGGTAATCAGGATCACAAAATCACAGGCAATAATTTATCGCTGACGGAAGGCGATCGAGGCATA
CAGGTTAAGGGCGATTTGGCGCAGAAAATCAGCGGCGTGTTCAGCGTGGACAGCAATGGCGATCTGACGC
TGCAAAGTGGCAGCAAACTGACACTCCGAGTTGGAGGCAGCTTTGTGGTTATCCACGCCGGAGGCGTTGA
CATCAAAGGGCCTGCTATCAACCTGAACTCAGGCGGCAGCCCAGGCGACTTGGCACTACCCGCCGATCCG
GCGATATTGAAAGCGGCGGCGGCACAGGGAACGATGTTTGTGGCGCATTGTCCGGCAAAGGAAAAAAAAG
GTGAGTGA