SecReT6
Effector Protein ID: 261823481
-
SecReT6 ID369
T6SS typeA3
Gene symbol-
Locus tagPecwa_4256
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]4702651..4703169 [+]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDD0KC92
KEGG IDpwa:Pecwa_4256
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.50E-35, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|261823481|ref|YP_003261587.1| type VI secretion system effector [Pectobacterium wasabiae WPP163]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVEGHEDEMLVQEFKHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLMYNALASGEMLPTVTLKWYRTSVEGKQEHFFSTVLTDATIVDVNCQMPHCQDPAKLDYTQ
LIEVSLAYRKIDWEHTVAGTSGSDDWRVPVEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|261819370|ref|NC_013421.1|:4702651-4703169 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGCCAACTCCATGCTATATCAGCATCGAAGGTAAAACACAGGGCAACATCACCGCAGGGGCTTTCACCT
CTGATTCTGTCGGCAACATCTACGTGGAAGGCCACGAAGACGAAATGCTGGTGCAGGAATTCAAGCACGT
CGTCACCGTACCAACCGACCCGCAGTCCGGTCAGCCATCCGGTCAGCGCGTCCACAAACCGTTCAAGTTC
ACCGTCGCGCTGAACAAAGCGGTACCGCTGATGTACAACGCCCTCGCCTCCGGCGAAATGCTGCCAACCG
TCACCCTGAAGTGGTATCGCACCTCGGTAGAAGGCAAACAGGAGCACTTCTTCTCTACCGTGCTGACCGA
TGCCACCATCGTTGACGTTAACTGCCAGATGCCACACTGCCAGGACCCGGCCAAGCTGGACTACACCCAA
CTGATTGAAGTCTCGCTGGCCTACCGCAAAATCGACTGGGAGCACACCGTCGCCGGCACCTCTGGCTCCG
ACGACTGGCGCGTGCCGGTCGAAGCCTAA