SecReT6
Effector Protein ID: 261823482
-
SecReT6 ID369
T6SS typeA3
Gene symbol-
Locus tagPecwa_4257
StrainPectobacterium wasabiae WPP163
Repliconchromosome [GenBank: NC_013421] [Browse all T6SS(s) in this replicon]
Location [Strand]4703358..4705190 [+]
ProductImpA family type VI secretion-associated protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDD0KC93
KEGG IDpwa:Pecwa_4257
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.50E-71, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 1.50E-22, Aligned region: 367..460
Phage_Mu_Gp45 [PF06890], Evalue: 0.0022, Aligned region: 419..446
Phage_Mu_Gp45 [PF06890], Evalue: 0.0022, Aligned region: 534..575
Protein Sequence: 610 a.a.     [Download]
>gi|261823482|ref|YP_003261588.1| ImpA family type VI secretion-associated protein [Pectobacterium wasabiae WPP163]
MANSTGLQFTVKVGALPASTFAVVDFQLSEALNRPFSLSLSLASALPDVDFGAVLDQPCELMIWYEGELK
RRVSGIISGFTQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQAQKPEAIIGTLLEEAGITDYAFSLRHD
HAPREYCVQYRESDLAFVTRLAAEEGLYFFHEFEEGKHRVVFADDAGALAKGPELFFNLATQGLSEGEYV
RRFHYAERVSTAEVELKDYSFKTPAYGLSHKKMSSELAHQRESYQHYDYPGRYKQDPSGKAFSNYQLDAL
RSEAVTSQGESNCAGLMPGRRFTLTEHPNATLNAVWQTVSVTHIGQQPQALEEESGGEPTTMSNSFEVIS
AKKNWRAIMPYKPMVDGPQIATVVGPTGEEIYCDQYGRIKLQFPWDRYGASDDQSSCWVRVSQGWAGSQY
GMIAIPRIGHEVIVSFLEGDPDQPIVTGRTFHVTNRPPYELPTHKTRTVLRSRTHKGKGFNELSFEDQSG
QEEVFIHAQKDMNTVVLNNRSTKVNIDHSENVGRHQTIMVGENQGTEIRGAQKITVAKGRKTEITTTEEL
TVTGDITVLSASGTIKLSTAGGYISIDNAGDINIVGNHLMLNGVRIDLNQ
-
Nucleotide Sequence: 1833 bp     [Download]
>gi|261819370|ref|NC_013421.1|:4703358-4705190 Pectobacterium wasabiae WPP163 chromosome, complete genome
ATGGCCAACAGTACAGGATTGCAGTTCACTGTAAAGGTCGGCGCGTTGCCGGCCTCGACGTTTGCGGTGG
TCGATTTTCAGCTCAGCGAGGCGCTTAACCGGCCTTTCAGCCTATCGCTGAGTCTGGCCAGCGCCCTGCC
GGATGTGGATTTTGGCGCGGTGCTGGACCAGCCGTGCGAGCTGATGATTTGGTATGAGGGTGAGCTAAAG
CGTCGGGTCAGCGGGATTATCAGTGGTTTCACACAGGGCGACACCGGTTTTCGCCGCACCCGCTATCAGG
CGGAAGTGCGCCCGGCGCTGTGGCGGCTGGGCTTACGTACCAACGCCCGCATCTTTCAGGCGCAGAAGCC
AGAGGCGATTATCGGCACCCTGCTGGAAGAAGCCGGGATTACCGACTACGCCTTCTCGTTACGTCATGAC
CATGCCCCGCGTGAATACTGCGTGCAGTACCGGGAAAGTGATTTGGCGTTTGTCACCCGACTGGCCGCAG
AGGAAGGCCTGTACTTCTTCCACGAATTTGAGGAAGGTAAACACCGGGTGGTCTTTGCCGACGATGCCGG
CGCATTGGCCAAAGGCCCTGAGTTGTTCTTCAATTTGGCGACACAGGGGCTGAGTGAGGGCGAATATGTC
CGGCGTTTCCACTATGCCGAGCGGGTGAGTACGGCAGAAGTGGAATTGAAGGATTACAGTTTCAAAACAC
CAGCTTACGGGCTGTCACACAAGAAGATGAGCAGCGAACTGGCGCACCAACGTGAAAGCTATCAGCATTA
CGACTATCCAGGGCGTTATAAACAAGATCCGAGCGGCAAAGCGTTCAGCAACTACCAGTTGGATGCACTG
CGTTCAGAGGCGGTGACAAGCCAAGGGGAATCGAACTGCGCGGGGCTGATGCCGGGCCGTCGCTTCACGT
TAACCGAACATCCGAATGCAACTCTGAATGCAGTGTGGCAAACGGTGAGCGTGACGCATATCGGGCAGCA
GCCACAGGCGCTGGAAGAAGAAAGCGGCGGCGAGCCAACGACCATGAGCAACAGTTTTGAAGTTATCAGT
GCAAAAAAAAACTGGCGAGCCATCATGCCGTACAAACCCATGGTGGATGGCCCACAGATTGCCACGGTGG
TAGGGCCGACTGGCGAAGAAATCTACTGTGACCAGTACGGCAGGATCAAACTGCAATTCCCGTGGGACCG
CTACGGCGCAAGTGATGACCAAAGCTCCTGCTGGGTGCGAGTGAGTCAGGGCTGGGCGGGCAGCCAGTAC
GGCATGATAGCCATCCCGCGCATCGGCCATGAAGTGATTGTCAGCTTCCTCGAAGGTGACCCGGACCAGC
CGATTGTCACCGGCAGAACCTTTCATGTAACTAACCGCCCTCCTTATGAGTTGCCCACCCACAAGACGCG
TACCGTTCTTCGTTCAAGAACGCATAAAGGAAAAGGCTTTAACGAACTGAGCTTTGAAGATCAGTCTGGA
CAGGAAGAAGTATTTATCCACGCCCAGAAAGACATGAACACCGTGGTGCTCAATAACCGCAGCACAAAGG
TGAACATCGACCACAGTGAAAATGTGGGTCGTCATCAGACAATCATGGTTGGCGAAAATCAGGGAACAGA
AATCAGAGGCGCCCAGAAGATCACGGTGGCAAAGGGCCGCAAGACCGAAATCACCACGACTGAAGAACTG
ACCGTAACCGGAGATATTACCGTGCTGTCAGCCAGCGGCACGATCAAATTATCTACCGCCGGTGGATATA
TCTCTATTGATAATGCTGGCGATATCAACATTGTCGGCAACCACCTGATGCTGAATGGCGTACGCATCGA
TTTGAACCAGTAG