SecReT6
Effector Protein ID: 262395327
-
SecReT6 ID370
T6SS typeA5
Gene symbol-
Locus tagVEA_000028
StrainVibrio sp. Ex25
Repliconchromosome II [GenBank: NC_013457] [Browse all T6SS(s) in this replicon]
Location [Strand]30056..30535 [+]
Producthemolysin-coregulated protein
Effector typeProtein
Homologous effectorVPA1027
DescriptionHcp protein
UniProt IDD0MCK1
KEGG IDvex:VEA_000028
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-30, Aligned region: 6..134
Protein Sequence: 159 a.a.     [Download]
>gi|262395327|ref|YP_003287180.1| hemolysin-coregulated protein [Vibrio sp. Ex25]
MQSNTYLKYADIKGEATAEQYKDLITLLSVDWSVGREISSYTGTAMDREASATRLYDLTITKLQDRSSPD
LFKEATIGKGKPAVFHITKQGEKVEEIMKIELTDAMISNYSVSIQDDRPVETITISYTEMMMTVTPTDDK
NNTSAPLVYGYSGVKGQQM
-
Nucleotide Sequence: 480 bp     [Download]
>gi|262395299|ref|NC_013457.1|:30056-30535 Vibrio sp. Ex25 chromosome 2, complete genome
ATGCAGTCTAATACGTATCTTAAATACGCAGATATTAAGGGTGAGGCAACTGCCGAGCAATATAAAGATT
TGATTACACTACTATCTGTAGATTGGAGTGTAGGTCGTGAGATCTCATCATACACTGGTACAGCGATGGA
CCGTGAAGCGAGCGCTACTCGTCTATATGATTTGACTATCACTAAACTTCAAGACCGTTCTTCTCCTGAC
TTATTTAAAGAAGCGACAATTGGTAAAGGTAAACCTGCGGTTTTCCATATTACTAAGCAGGGTGAGAAAG
TTGAAGAAATCATGAAGATCGAACTGACTGATGCGATGATTTCTAACTACTCAGTTTCTATCCAGGATGA
TCGTCCAGTTGAAACCATCACTATTTCTTACACTGAAATGATGATGACAGTGACTCCTACTGACGATAAA
AACAACACTTCTGCGCCATTGGTATACGGCTACAGCGGTGTTAAAGGTCAACAAATGTAA