SecReT6
Effector Protein ID: 269138654
cspA
SecReT6 ID372
T6SS typeA4b
Gene symbolcspA
Locus tagETAE_1303
StrainEdwardsiella tarda EIB202
Repliconchromosome [GenBank: NC_013508] [Browse all T6SS(s) in this replicon]
Location [Strand]1411812..1412027 [-]
Productmajor cold shock protein
Effector typeProtein
Homologous effectorETAE_1303
DescriptionThe translocation of the effector is T6SS-dependent, identified from the macrophage infection-responsive E.piscicida genes.
UniProt IDD0ZG90
KEGG IDetr:ETAE_1303
PDB IDNA
Domain hit(s) vs Pfam CSD [PF00313], Evalue: 7.7e-31, Aligned region: 5-71
Protein Sequence: 71 a.a.     [Download]
>gi|269138654|ref|YP_003295355.1| cspA gene product [Edwardsiella tarda EIB202]
MSNKMTGLVKWFNADKGFGFITPDNGGSDIFVHFSAIQSNGYKSLDEGQKVAFEVQTGAAKGPSAINVTP
L
-
Nucleotide Sequence: 216 bp     [Download]
>gi|269137358|ref|NC_013508.1|:c1412027-1411812 Edwardsiella tarda EIB202 chromosome, complete genome
ATGTCTAATAAAATGACTGGCTTAGTAAAATGGTTCAATGCGGATAAAGGCTTTGGTTTCATCACGCCGG
ATAACGGCGGCAGCGATATCTTTGTTCATTTTTCCGCAATTCAAAGCAATGGCTACAAATCCCTGGACGA
AGGCCAGAAGGTTGCATTCGAAGTGCAAACCGGCGCAGCTAAAGGGCCGTCAGCCATTAATGTAACCCCG
CTGTAA

Reference
(1) Zhang L, Jiang Z, Fang S, Huang Y, Yang D, Wang Q, Zhang Y, Liu Q (2018). Systematic Identification of Intracellular-Translocated Candidate Effectors in Edwardsiella piscicida. Front Cell Infect Microbiol. 8:37. [PudMed:29503811] experimental
 
experimental experimental literature