SecReT6
Effector Protein ID: 269139481
cspI
SecReT6 ID372
T6SS typeA4b
Gene symbolcspI
Locus tagETAE_2136
StrainEdwardsiella tarda EIB202
Repliconchromosome [GenBank: NC_013508] [Browse all T6SS(s) in this replicon]
Location [Strand]2248536..2248751 [+]
Productmajor cold shock protein
Effector typeProtein
Homologous effectorETAE_2136
DescriptionThe translocation of the effector is T6SS-dependent, identified from the macrophage infection-responsive E.piscicida genes.
UniProt IDD0Z9J5
KEGG IDetr:ETAE_2136
PDB IDNA
Domain hit(s) vs Pfam CSD [PF00313], Evalue: 3.0e-33, Aligned region: 5-70
Protein Sequence: 71 a.a.     [Download]
>gi|269139481|ref|YP_003296182.1| cspI gene product [Edwardsiella tarda EIB202]
MSNKMTGSVKWFNADKGFGFISPADGSKDVFVHFSAIQSNEFRTLDEGQQVEFSVENGPKGPSAVNVVAI
N
-
Nucleotide Sequence: 216 bp     [Download]
>gi|269137358|ref|NC_013508.1|:2248536-2248751 Edwardsiella tarda EIB202 chromosome, complete genome
ATGTCTAATAAAATGACTGGTTCTGTAAAATGGTTCAACGCCGATAAAGGCTTCGGCTTTATCTCCCCGG
CTGATGGCAGCAAGGACGTTTTCGTTCATTTCTCTGCCATTCAAAGCAACGAATTCCGCACTCTGGATGA
AGGCCAACAGGTTGAGTTCTCTGTAGAGAATGGTCCTAAAGGTCCTTCAGCTGTAAACGTAGTTGCTATC
AACTAA

Reference
(1) Zhang L, Jiang Z, Fang S, Huang Y, Yang D, Wang Q, Zhang Y, Liu Q (2018). Systematic Identification of Intracellular-Translocated Candidate Effectors in Edwardsiella piscicida. Front Cell Infect Microbiol. 8:37. [PudMed:29503811] experimental
 
experimental experimental literature