SecReT6
Effector Protein ID: 269139773
evpP
SecReT6 ID372
T6SS typeA4b
Gene symbolevpP
Locus tagETAE_2428
StrainEdwardsiella tarda EIB202
Repliconchromosome [GenBank: NC_013508] [Browse all T6SS(s) in this replicon]
Location [Strand]2554834..2555136 [+]
Producttype VI secretion system protein EvpP
Effector typeProtein
Homologous effectorEvpP
DescriptionEvpP inhibits neutrophils recruitment through Jnk-caspy-inflammasome cascades in vivo.
UniProt IDD0ZB29
KEGG IDetr:ETAE_2428
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 100 a.a.     [Download]
>gi|269139773|ref|YP_003296474.1| evpP gene product [Edwardsiella tarda EIB202]
MLIAKQNGVSMREWGRLTSVIKENWSSLDFLLEIVLKIPVYAWFGGFKGMSRIDNGMTSKRNITLEQKGR
SSMLPGGATQFYIPNLTVGHISSHQFSILK
-
Nucleotide Sequence: 303 bp     [Download]
>gi|269137358|ref|NC_013508.1|:2554834-2555136 Edwardsiella tarda EIB202 chromosome, complete genome
ATGCTGATCGCTAAGCAAAACGGGGTATCAATGAGGGAATGGGGACGACTCACCTCCGTGATCAAAGAAA
ACTGGAGCTCTCTCGACTTTTTACTTGAGATAGTCCTAAAGATTCCCGTCTATGCCTGGTTCGGTGGATT
TAAGGGCATGTCGCGCATTGATAATGGTATGACCTCTAAACGAAATATCACGCTGGAACAAAAAGGCCGG
AGCTCAATGCTCCCCGGCGGGGCCACACAGTTCTATATTCCAAACCTGACGGTCGGGCATATCAGTAGCC
ACCAATTTTCAATATTGAAATAG

Reference
(1) Tan J, Yang D, Wang Z, Zheng X, Zhang Y, Liu Q (2019). EvpP inhibits neutrophils recruitment via Jnk-caspy inflammasome signaling in vivo. Fish Shellfish Immunol. 92:851-860. [PudMed:31129187] experimental
(2) Chen H, Yang D, Han F, Tan J, Zhang L, Xiao J, Zhang Y, Liu Q (2017). The Bacterial T6SS Effector EvpP Prevents NLRP3 Inflammasome Activation by Inhibiting the Ca2+ -Dependent MAPK-Jnk Pathway. Cell Host Microbe. 21(1):47-58. [PudMed:28081443] experimental
(3) Zheng J et al. (2007). Dissection of a type VI secretion system in Edwardsiella tarda. Mol Microbiol. 66(5):1192-206. [PudMed:17986187] experimental
 
experimental experimental literature