SecReT6
Effector Protein ID: 269139776
evpC
SecReT6 ID372
T6SS typeA4b
Gene symbolevpC
Locus tagETAE_2431
StrainEdwardsiella tarda EIB202
Repliconchromosome [GenBank: NC_013508] [Browse all T6SS(s) in this replicon]
Location [Strand]2557455..2557946 [+]
Producttype VI secretion system protein EvpC
Effector typeProtein
Homologous effectorEvpC
DescriptionHcp protein
UniProt IDD0ZB32
KEGG IDetr:ETAE_2431
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.20E-35, Aligned region: 6..137
Protein Sequence: 163 a.a.     [Download]
>gi|269139776|ref|YP_003296477.1| evpC gene product [Edwardsiella tarda EIB202]
MAFDTYIKLDKVDGESTDDKHKKWIEVLGFAWGAGNECTMESGTQGLNTGKAMMSVLRVTKWMDCASVKL
ASAAVQGQNFPTLELEICTQAGDKFAFCIYKFTHVAVSSYQCSGATGGSDRPQETIDFAYKEVTWEYVPQ
DQNGKAGGKIGPEGWSLITNKKK
-
Nucleotide Sequence: 492 bp     [Download]
>gi|269137358|ref|NC_013508.1|:2557455-2557946 Edwardsiella tarda EIB202 chromosome, complete genome
ATGGCTTTTGATACTTATATCAAACTGGATAAGGTTGATGGGGAATCCACCGACGATAAGCACAAAAAAT
GGATTGAAGTGCTGGGTTTTGCCTGGGGAGCCGGCAATGAATGCACGATGGAGAGCGGCACCCAGGGGCT
GAATACCGGTAAGGCGATGATGTCGGTGCTGCGTGTCACCAAATGGATGGACTGCGCCAGTGTCAAGCTG
GCCTCCGCCGCCGTGCAGGGGCAGAACTTTCCCACGCTGGAGCTGGAGATTTGCACCCAGGCGGGCGATA
AGTTCGCCTTCTGCATCTACAAATTTACGCATGTCGCCGTCTCCAGCTATCAATGCTCAGGGGCCACGGG
CGGCAGCGATCGCCCGCAGGAAACCATTGATTTCGCTTATAAAGAAGTGACCTGGGAATACGTTCCCCAG
GATCAGAACGGCAAGGCGGGCGGCAAAATTGGTCCTGAGGGCTGGAGCCTGATTACCAACAAGAAAAAGT
AA

Reference
(1) Zheng J et al. (2007). Dissection of a type VI secretion system in Edwardsiella tarda. Mol Microbiol. 66(5):1192-206. [PudMed:17986187] experimental
 
experimental experimental literature