SecReT6
Effector Protein ID: 269139782
evpI
SecReT6 ID372
T6SS typeA4b
Gene symbolevpI
Locus tagETAE_2437
StrainEdwardsiella tarda EIB202
Repliconchromosome [GenBank: NC_013508] [Browse all T6SS(s) in this replicon]
Location [Strand]2565397..2567316 [+]
Producttype VI secretion system protein EvpI
Effector typeProtein
Homologous effectorEvpI
Descriptiontype VI secretion system Vgr family protein
UniProt IDD0ZB38
KEGG IDetr:ETAE_2437
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 6.90E-79, Aligned region: 7..308
Phage_GPD [PF05954], Evalue: 6.90E-79, Aligned region: 338..356
Phage_base_V [PF04717], Evalue: 9.50E-24, Aligned region: 177..196
Phage_base_V [PF04717], Evalue: 9.50E-24, Aligned region: 344..436
Protein Sequence: 639 a.a.     [Download]
>gi|269139782|ref|YP_003296483.1| evpI gene product [Edwardsiella tarda EIB202]
MVQCRGEEAIADLYRFELELFSTDPALAWQSLVGQAAALRLALPNGQTRYWHGVIGRAAYRGAEQHGFAY
YAELVPRLAWLQHAQECQIFQEKTVPQIIEAVLKARGISDFRLSLSQRYAPREYCVQYRESDLSFISRLM
EEEGIFYWFEHSESRHVLVLADGNAAVQPCKVRSDIVYRPKHRSESGDDIQWWMPSLAVVPANVFLNAYT
FEQPTAHLLTSSASVAKQGKLSDVAVYDFTDDYTQTREGERRAKLKMEGLEAMQARIEGGGRCRTLAPGY
GFSLQKHFRKDCNGDYLLLSVRHEIVNNLPWQEQEVNYQNHFICLPKSLPYRTLSQTPRPVIHGVQTAVV
TGPQGEEIHTDRHGRVKVHFHWDRLGTQDDKSSCWIRVAQGWAGLGWGGMQLPRVGQEVIVDFVDGNPDA
PLITGRVYNAHQTPPFKLPDNKTQSGIQTRSTPNGNPEHFSLLRFEDKMGAEEVFMQAERDFRRRVKHDD
ELTVEHDRRVTIKNDCAETVSEGNYLQSITKGKHTRVIEGDALTEVKSGNSTLQVNKGDHATTASAGSLH
LKAGTAITLSVGSNRIVIDSGGVLIEGMNITVKGKQSIALSGLSVAITGTQSASLSSSAEAEVSSSVMTS
IKGGIVKIN
-
Nucleotide Sequence: 1920 bp     [Download]
>gi|269137358|ref|NC_013508.1|:2565397-2567316 Edwardsiella tarda EIB202 chromosome, complete genome
GTGGTGCAGTGCCGGGGCGAAGAGGCGATCGCCGATCTCTACCGCTTTGAGCTGGAGCTGTTCTCCACGG
ACCCCGCGCTGGCGTGGCAATCGCTGGTCGGGCAGGCCGCCGCGCTGCGGCTGGCCTTGCCGAATGGCCA
GACCCGCTACTGGCATGGCGTGATCGGCCGGGCCGCCTACCGGGGCGCCGAGCAACACGGATTTGCCTAT
TATGCCGAGCTGGTACCGCGCCTGGCCTGGCTGCAGCACGCCCAGGAGTGTCAGATCTTCCAGGAGAAGA
CGGTCCCGCAGATTATTGAAGCGGTGCTTAAGGCGCGGGGCATCAGCGATTTTCGCCTCTCGCTGTCGCA
GCGCTACGCCCCCCGGGAATACTGCGTACAGTATCGCGAATCGGACCTCAGCTTCATCAGCCGACTGATG
GAGGAAGAGGGCATTTTCTACTGGTTCGAACACAGCGAAAGCCGCCATGTGCTGGTATTGGCCGATGGCA
ATGCCGCGGTCCAACCCTGCAAGGTGCGCTCAGACATCGTCTATCGACCTAAGCATAGGAGCGAATCCGG
CGATGATATCCAGTGGTGGATGCCCTCCCTCGCGGTCGTGCCGGCCAACGTCTTCCTGAATGCCTATACC
TTTGAGCAGCCGACCGCCCATTTGCTGACCTCCAGCGCCTCCGTGGCCAAGCAGGGCAAATTGAGCGACG
TGGCGGTCTACGATTTCACCGATGACTATACGCAGACCCGGGAGGGCGAACGCCGCGCCAAGCTGAAGAT
GGAGGGGCTAGAGGCCATGCAGGCCCGGATAGAGGGCGGCGGACGCTGCCGCACGCTGGCGCCGGGCTAT
GGGTTCAGCCTGCAAAAACATTTCCGCAAAGACTGTAACGGTGACTATCTGCTGCTAAGCGTACGGCACG
AGATCGTCAACAACCTGCCGTGGCAGGAGCAAGAGGTGAACTACCAGAACCACTTTATCTGTCTCCCCAA
ATCCCTGCCCTACCGCACCCTAAGCCAAACGCCCCGCCCGGTGATCCATGGCGTACAGACTGCCGTGGTC
ACCGGTCCGCAGGGCGAGGAGATCCATACCGATCGGCATGGCCGGGTTAAGGTTCATTTTCACTGGGATC
GCCTGGGAACGCAGGATGATAAAAGCTCCTGCTGGATCCGGGTGGCGCAGGGCTGGGCCGGGCTGGGCTG
GGGGGGGATGCAGCTGCCCCGCGTAGGGCAGGAGGTGATCGTGGATTTTGTCGATGGCAATCCGGACGCC
CCCCTGATCACCGGCCGGGTCTATAACGCCCACCAGACGCCCCCCTTCAAGCTGCCTGACAATAAGACCC
AAAGCGGTATTCAGACCCGCAGCACCCCCAATGGCAATCCGGAGCACTTCAGCCTGCTGCGCTTCGAGGA
CAAGATGGGGGCGGAAGAGGTGTTCATGCAGGCGGAGCGGGATTTTCGCCGCCGGGTGAAACACGATGAC
GAACTGACGGTCGAGCACGACCGCCGGGTGACCATCAAGAATGACTGCGCCGAGACGGTCTCCGAGGGGA
ACTACCTGCAGAGCATCACCAAGGGCAAGCATACCCGGGTGATCGAGGGCGATGCCCTCACGGAGGTGAA
GTCAGGCAACAGTACGCTGCAGGTGAACAAGGGGGATCACGCCACCACCGCCTCGGCGGGCAGCCTCCAT
CTGAAGGCAGGAACCGCGATAACCCTGAGCGTGGGCAGCAATCGTATCGTCATTGACAGCGGCGGCGTGC
TCATCGAGGGCATGAATATCACGGTGAAGGGGAAACAGTCCATTGCGCTATCCGGCCTCAGCGTCGCGAT
AACGGGCACCCAATCGGCCAGCCTGAGCAGTTCGGCAGAGGCGGAGGTCTCCTCGTCCGTGATGACCTCC
ATCAAGGGCGGTATTGTCAAGATCAACTGA

Reference
(1) Zheng J et al. (2007). Dissection of a type VI secretion system in Edwardsiella tarda. Mol Microbiol. 66(5):1192-206. [PudMed:17986187] experimental
 
experimental experimental literature