SecReT6
Effector Protein ID: 26989334
hcp-1
SecReT6 ID13
T6SS typeA1
Gene symbolhcp-1
Locus tagPP_2615
StrainPseudomonas putida KT2440
Repliconchromosome [GenBank: NC_002947] [Browse all T6SS(s) in this replicon]
Location [Strand]2991551..2992066 [-]
Producthcp protein
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDQ88JN4
KEGG IDppu:PP_2615
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.70E-38, Aligned region: 6..155
Protein Sequence: 171 a.a.     [Download]
>gi|26989334|ref|NP_744759.1| hcp-1 gene product [Pseudomonas putida KT2440]
MPTPAYIKIVGQTQGNITAGAFTADSVGNVFQQGHEDQILVQEIKHEVTTPTDPQSGQPSGQRVHKPFIF
TSSLNKATPLMYQALANGEMLPTVEVSWYRTSSEGKQEHFFTTTLEDATIVSINTVLPHALDKDNENYTQ
LVEVSLAYRKITWAHDVANTEGSDDWRAPAA
-
Nucleotide Sequence: 516 bp     [Download]
>gi|26986745|ref|NC_002947.3|:c2992066-2991551 Pseudomonas putida KT2440 chromosome, complete genome
ATGCCAACACCCGCTTACATCAAGATCGTAGGCCAGACCCAAGGCAACATCACCGCTGGCGCCTTCACCG
CTGACTCCGTCGGCAACGTGTTCCAACAAGGCCATGAAGATCAGATTCTGGTTCAGGAAATCAAGCATGA
GGTGACTACGCCCACTGACCCCCAGAGCGGTCAACCGAGTGGCCAGCGCGTGCATAAGCCTTTCATATTC
ACCAGTTCACTGAACAAAGCTACCCCCCTGATGTATCAGGCACTTGCCAACGGCGAAATGCTGCCAACGG
TCGAGGTCAGCTGGTATCGCACCTCGTCGGAAGGCAAACAAGAGCATTTTTTCACCACCACGCTCGAAGA
CGCCACCATCGTCAGCATCAATACCGTGCTTCCCCACGCACTCGACAAAGACAATGAAAACTACACCCAA
CTGGTTGAAGTATCGCTGGCGTATCGAAAGATCACGTGGGCTCACGATGTAGCCAACACCGAAGGCTCTG
ACGACTGGCGCGCACCCGCCGCCTGA