SecReT6
Effector Protein ID: 271499836
-
SecReT6 ID373
T6SS typeA1
Gene symbol-
Locus tagDd586_1272
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T6SS(s) in this replicon]
Location [Strand]1418778..1419296 [+]
Producttype VI secretion system effector, Hcp1 family
Effector typeProtein
Homologous effectorECA4275
DescriptionHcp protein
UniProt IDD2BVK2
KEGG IDddc:Dd586_1272
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.10E-37, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|271499836|ref|YP_003332861.1| type VI secretion system effector, Hcp1 family [Dickeya dadantii Ech586]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVQGHEDEMLVQEFKHIVTVPTDPQSGQPAGQRVHKPFKF
TVALNKAVPLLYNALASGEMLPTVTLKWYRTSVEGKQEHFFTTKLTDATIVDINNQMPHCQDPSKQDYTQ
LIEVSLAYRKIDWEHTVAGTSGSDDWRAPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|271498578|ref|NC_013592.1|:1418778-1419296 Dickeya dadantii Ech586 chromosome, complete genome
ATGCCAACTCCATGCTATATCAGCATCGAAGGTAAAACCCAGGGCAACATCACTGCCGGTGCCTTCACCT
CCGACTCCGTCGGCAACATCTACGTGCAGGGTCACGAAGACGAGATGCTGGTGCAGGAATTCAAACACAT
CGTCACCGTACCGACCGACCCGCAGTCCGGCCAGCCTGCCGGTCAGCGCGTGCACAAACCGTTCAAGTTC
ACCGTCGCGCTGAACAAAGCCGTCCCGCTGCTGTATAACGCGCTGGCCTCCGGCGAAATGCTGCCGACCG
TGACCCTGAAGTGGTACCGCACCTCTGTCGAAGGCAAGCAGGAGCATTTCTTCACCACCAAACTGACCGA
CGCCACCATCGTCGACATCAACAACCAGATGCCGCACTGCCAGGACCCGTCCAAGCAGGATTACACCCAG
CTGATCGAAGTGTCGCTGGCGTACCGCAAAATCGACTGGGAACACACCGTGGCCGGGACTTCCGGCTCTG
ACGACTGGCGCGCGCCGATCGAAGCGTAA