SecReT6
Effector Protein ID: 271499837
-
SecReT6 ID373
T6SS typeA1
Gene symbol-
Locus tagDd586_1273
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T6SS(s) in this replicon]
Location [Strand]1419461..1421497 [+]
Producttype VI secretion system Vgr family protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDD2BVK3
KEGG IDddc:Dd586_1273
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.90E-71, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 1.00E-22, Aligned region: 367..459
Protein Sequence: 678 a.a.     [Download]
>gi|271499837|ref|YP_003332862.1| type VI secretion system Vgr family protein [Dickeya dadantii Ech586]
MANSTGLQFTVKIGALADTTFAVVDFELSEALNQPFALSLSLASSQADIDFGAVLDQPCELLVWYEGELQ
RRVSGIVSRFAQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQTKKPDEIITELLQEAGISDFAFALRHE
HAAREYCVQYRESDLAFINRLAAEEGMFYYHEFEAGKHRVVFADDAGALTKGPELFFNLATQGLSEGAYV
RRFRYAEAVSTAEVELKDYSFKTPAYGLSHKKTSNELAHQRESYQHFDYPGRFKQDPSGKAFTGYRLDAL
RAGAMTGSGESNAAELRPGGTFTLTEHPNPAFNLAWQVVAVTHSGQQPQALEEESGGEPTTISNSFEVVK
ATTTWRAAMPYKPMVDGPQIAMVVGPAGEEIYCDKFGRVKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVVVSFLEGDPDQPIITGRTFHATNPTPYVLPEHKTRTTLRTDTHKGSGFNELRFEDEAT
REQIYLHAQKDMDAVINNIHRQSVGLDQHLSVANDQFQRVDRHSHRTIGQDDFEQIGQDHHQSIGRHFVQ
RITQSFKRFIGGGEITRIDGSRQTTLSGSEETLIGAHQRVLVNTDSYLKAADIVLEAGQSLTIKAPGGFI
KIDGAGVTISGTLVKINDGGSAGAGTAPVSIEPESPTRPTLPDAPDRR
-
Nucleotide Sequence: 2037 bp     [Download]
>gi|271498578|ref|NC_013592.1|:1419461-1421497 Dickeya dadantii Ech586 chromosome, complete genome
GTGGCCAACAGTACAGGATTGCAGTTTACCGTGAAAATCGGCGCATTGGCGGACACGACCTTCGCGGTGG
TGGATTTTGAACTCAGTGAAGCGCTGAACCAGCCGTTTGCGCTGTCGCTGAGCCTTGCCAGCAGTCAGGC
GGATATTGACTTCGGCGCGGTGCTGGACCAGCCATGCGAGCTGCTGGTGTGGTACGAAGGCGAACTGCAG
CGCCGGGTCAGCGGTATCGTCAGCCGCTTTGCCCAGGGCGACACCGGTTTTCGCCGCACCCGCTATCAGG
CCGAGGTGCGCCCGGCGCTGTGGCGGCTCGGTCTGCGTACCAACGCCCGCATCTTCCAGACCAAAAAACC
GGATGAGATCATCACCGAACTGTTGCAGGAAGCCGGTATCAGCGACTTTGCCTTTGCCCTGCGCCACGAG
CATGCGGCACGTGAGTACTGCGTGCAGTACCGCGAAAGCGACCTGGCGTTCATCAACCGGCTGGCGGCAG
AAGAAGGGATGTTCTACTACCACGAGTTTGAGGCCGGGAAACACCGGGTGGTGTTTGCCGATGACGCCGG
TGCGCTGACCAAAGGCCCCGAGCTGTTCTTCAATCTCGCCACGCAAGGGCTGAGCGAAGGGGCGTATGTG
CGCCGTTTCCGTTATGCCGAGGCGGTGAGCACCGCTGAGGTGGAACTGAAGGATTACAGCTTCAAAACCC
CGGCGTATGGCCTGTCGCACAAGAAAACCAGCAACGAACTGGCGCACCAGCGTGAATCCTACCAGCACTT
CGATTATCCCGGCCGCTTCAAGCAGGACCCGAGCGGCAAGGCCTTTACCGGCTACCGGCTGGACGCGCTG
CGTGCCGGGGCGATGACCGGCAGTGGCGAATCCAACGCCGCCGAACTGAGGCCGGGTGGCACCTTTACCC
TGACCGAGCACCCGAACCCGGCGTTTAACCTGGCCTGGCAGGTGGTGGCGGTGACCCACAGCGGCCAGCA
GCCGCAGGCGCTGGAAGAGGAAAGCGGTGGCGAGCCGACCACCATTAGCAACAGCTTCGAAGTGGTGAAA
GCCACCACCACCTGGCGGGCGGCCATGCCGTACAAGCCGATGGTGGACGGCCCGCAGATTGCCATGGTTG
TCGGCCCGGCGGGGGAAGAGATTTACTGTGATAAATTTGGCCGGGTGAAGCTGCAGTTCCCGTGGGACCG
CTACGGTGCCAGCGACGACCAGAGCTCCTGCTGGGTACGCGTCAGTCAGGGCTGGGCCGGTGGCCAGTAC
GGCTTGATCGCCATTCCGCGCATCGGTCATGAAGTGGTGGTGAGCTTTCTGGAAGGCGACCCGGACCAGC
CGATTATCACCGGTCGCACCTTTCATGCGACTAACCCGACGCCGTATGTCTTACCGGAGCATAAAACCCG
CACCACCTTGCGTACCGATACGCACAAAGGCAGCGGATTCAACGAGCTGCGGTTTGAAGATGAAGCGACC
CGGGAGCAAATCTACCTGCACGCGCAAAAAGACATGGATGCGGTGATTAACAACATTCATCGCCAGAGTG
TCGGGTTGGATCAGCATCTGAGCGTAGCGAATGACCAGTTCCAGCGGGTCGATCGTCATAGCCATCGCAC
CATCGGACAGGATGACTTTGAGCAGATTGGTCAGGATCATCACCAGTCAATCGGGCGTCATTTCGTGCAA
CGCATCACCCAGTCGTTCAAGCGCTTTATTGGTGGCGGCGAGATTACCCGTATTGACGGCAGCCGCCAGA
CCACGTTGTCCGGTTCGGAAGAGACCTTAATTGGCGCACATCAGCGTGTGCTGGTCAATACCGACAGTTA
CCTCAAAGCGGCGGATATCGTGCTGGAAGCCGGACAATCGCTGACCATTAAAGCGCCCGGCGGGTTTATT
AAGATTGACGGCGCGGGTGTCACCATTTCCGGCACGCTGGTGAAAATTAACGACGGTGGTTCCGCCGGGG
CGGGTACGGCGCCAGTGTCCATCGAACCCGAGTCCCCCACCAGACCGACGCTGCCCGATGCGCCGGACCG
GCGTTAA