SecReT6
Effector Protein ID: 271500022
-
SecReT6 ID373
T6SS typeA1
Gene symbol-
Locus tagDd586_1474
StrainDickeya dadantii Ech586
Repliconchromosome [GenBank: NC_013592] [Browse all T6SS(s) in this replicon]
Location [Strand]1668092..1672372 [+]
ProductYD repeat-containing protein
Effector typeProtein
Homologous effectorDda3937_01758
DescriptionRhsA
UniProt IDD2BWV8
KEGG IDddc:Dd586_1474
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 410..424
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 466..493
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 486..513
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 553..585
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 592..627
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 612..647
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 633..669
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 654..692
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 676..711
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 741..757
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 766..799
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 806..842
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 847..879
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 867..896
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 903..921
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 940..971
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 962..991
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 998..1024
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 1011..1041
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 1065..1094
RHS_repeat [PF05593], Evalue: 5.30E-52, Aligned region: 1112..1140
PAAR_motif [PF05488], Evalue: 9.30E-18, Aligned region: 9..22
PAAR_motif [PF05488], Evalue: 9.30E-18, Aligned region: 113..178
Tox-GHH2 [PF15635], Evalue: 2.10E-14, Aligned region: 1313..1401
RHS [PF03527], Evalue: 0.00013, Aligned region: 568..581
RHS [PF03527], Evalue: 0.00013, Aligned region: 634..646
RHS [PF03527], Evalue: 0.00013, Aligned region: 1055..1065
RHS [PF03527], Evalue: 0.00013, Aligned region: 1205..1223
Protein Sequence: 1426 a.a.     [Download]
>gi|271500022|ref|YP_003333047.1| YD repeat-containing protein [Dickeya dadantii Ech586]
MLNDILSRVARVGAMHAGNRPNPPADRPQPCQGKPPTSPGKTIKHKSFLGALAGAVAGALVAAAVAAVAV
FLVGVTGGLAVAAVGALAVFAAGDLISAVTNKVSAMVDSASPAFGPVASGSGNVFVEKQPVARATKDTVA
CTKHNSPQLIAQGSESVFVNDAPAARIDDKTVCGATIKEGASTVFFGSGQGTYLEIADEFSWWEKALLIA
VEFLVPPSRGMFRGLGKLFTRGPMAVLKGMRAGALKTLEGLKSAVKCASDGFRNNKGLSRVTEAVRGFLK
DPVYIASGEVIESRTDIALGQTLPLVFERTYRSASGHVGLLGRGWHDSWSEVATVTRDGLNTHVVITLAQ
GYDIDFTFHQDVQAVYCPHYPEFTLHRRGDGFSLWHRDQQTWRDFSVVQGERRLLSALHDSHDNRIELVR
DPKGYLRQVRHSDGVTLLLVWQGEFLHQIQRIDGGQKTLLAEYRQDEQGRLVEANATHAYHLYYEYDTAH
RLTRWHDNDQTWARYEYDAQGRCVYTTCADGFLTARFDYLPDRVVMTDGLGQRSEFGFNDLHLMSWEQSP
LGHVTRYDYDEVGNLLREISPAGRVVEFGYLDDTGRVSTFTDASGHQWQYDYDDALRLCGVTDPLGREWG
WVYDAEGNPERLTGPDASEVRFTWNRYGLLTQVSDAAGEVQARLQYDHRQRLLSATDAESRTRQLRYDGQ
DRVVQWQRADGARFRLGYRRASWTLPEQLIRPDDKEELRQYDRHNNLLSYVDGNGALWRQTFGPFDLLTA
RTDAEGRTWHYAYDKESQQLTAVIAPDGSRWQWWLDADGRVIRERDMTGTETHYSYDEDGLCVSVRNGEG
DTRHFLYDARGLLLRETAPDDTLHYRYDAVGRLTEVSSATAHVQLDYDLCDRVVREWHNGTLLTRQYDDA
ARTVTRTLTWDGDADDTTGTLAPLTSLFHYTRTGELRQVQLPDGADLTLTHDAAGRESHRRGGSGFVQQR
EYDVMGWLTREMSGAQHDGHLLAAQTREYRYDGAGNLTGVRHNRDAEGYRLDATGRVQAVLSGGAGKPVD
TLARFHYTRSGLPQEAGRLTEWQSGRLVQHDDTHYQYDRAGRLIRKQVVQPGYRPQVWQYRWDSRNQLRV
VDTPTGERWLYRYDPFGRRVGKRCDQKAEEIRYQWDGDQIAEIRHYRHGQLVARRHWVYNGWELVVQQRQ
HTGGDWETDFVTSSQNGTPQALFTPDGTLRWQAPKATLWGQRQAEKSESPDPGLAFAGQLRDSESGLCYN
RFRYYDPAGGCYVSPDPIGVLGGESNYGYVYNPISGIDPLGLNGKKCMGVSESGHHVPSVRKSQGRPFEV
ARSDKTRPTLFPRGKEPEHDHWRMHDAERKYVGPRQGDFAGSDKELFDAYKKAYSSLDDIKVDVRSPNGT
HILGSNVTPSQAVDLIENWLTKQGLM
-
Nucleotide Sequence: 4281 bp     [Download]
>gi|271498578|ref|NC_013592.1|:1668092-1672372 Dickeya dadantii Ech586 chromosome, complete genome
ATGCTCAACGATATTCTGAGCCGGGTGGCCCGGGTGGGGGCCATGCATGCCGGAAACCGTCCCAACCCGC
CCGCCGACCGGCCGCAACCCTGTCAGGGTAAACCGCCAACGTCGCCGGGTAAGACCATCAAACACAAGAG
TTTTCTCGGTGCACTGGCCGGGGCCGTGGCCGGGGCGCTGGTGGCAGCGGCCGTGGCAGCCGTGGCGGTA
TTTCTGGTGGGGGTGACCGGCGGACTGGCGGTGGCGGCCGTCGGGGCACTGGCCGTGTTTGCCGCCGGTG
ACCTGATTTCCGCCGTCACCAACAAGGTGTCGGCGATGGTGGACAGTGCGTCACCGGCCTTCGGGCCGGT
GGCGTCCGGCTCGGGTAACGTGTTTGTTGAAAAACAGCCCGTCGCCCGCGCCACGAAAGACACCGTTGCC
TGCACCAAGCACAACAGCCCGCAACTGATTGCCCAGGGCAGCGAGTCGGTGTTCGTGAACGACGCACCAG
CCGCCCGTATCGACGATAAAACCGTCTGTGGTGCCACTATCAAGGAAGGGGCCTCAACGGTATTTTTCGG
CTCCGGGCAGGGCACCTATCTGGAGATTGCCGACGAGTTCAGTTGGTGGGAAAAGGCGCTGCTGATTGCG
GTGGAGTTTCTGGTACCGCCCAGTCGTGGGATGTTCAGGGGGCTGGGTAAACTGTTCACCCGCGGGCCGA
TGGCGGTACTAAAAGGGATGCGCGCCGGGGCGCTGAAAACGCTGGAAGGACTGAAAAGCGCCGTTAAATG
TGCCAGTGACGGATTTCGCAACAATAAGGGGCTGTCGCGTGTCACGGAAGCGGTGCGCGGCTTCCTCAAA
GACCCGGTCTACATCGCCAGCGGCGAGGTGATTGAATCCCGTACCGATATCGCGCTGGGCCAGACGCTGC
CGCTGGTGTTCGAACGCACCTACCGCTCCGCCTCCGGGCATGTCGGGCTGCTGGGCCGCGGCTGGCACGA
CAGCTGGAGCGAGGTGGCGACGGTAACGCGCGACGGCCTCAACACCCACGTGGTCATCACGCTGGCTCAG
GGCTACGACATCGATTTTACCTTCCATCAGGACGTACAGGCGGTGTACTGCCCGCACTACCCTGAATTTA
CCCTGCACCGCCGGGGCGACGGTTTCAGCCTGTGGCACCGCGACCAGCAGACCTGGCGCGACTTTAGCGT
GGTACAGGGCGAGCGCCGGTTGCTGTCGGCCCTTCACGATAGCCACGACAACCGCATCGAGCTGGTGCGC
GACCCGAAAGGCTACCTGCGCCAGGTGCGCCACAGCGACGGCGTCACTCTGCTGCTGGTGTGGCAGGGCG
AATTCCTGCACCAGATACAACGCATCGATGGCGGCCAGAAGACGCTGCTGGCCGAGTACCGGCAGGACGA
ACAGGGCCGACTGGTGGAAGCCAACGCCACCCACGCCTATCACCTCTATTACGAGTACGACACCGCCCAC
CGGCTGACCCGCTGGCACGATAACGACCAGACCTGGGCGCGCTACGAATACGACGCACAGGGGCGTTGCG
TCTACACCACCTGCGCCGACGGTTTTCTGACCGCCCGCTTCGATTACCTGCCCGACCGGGTGGTGATGAC
CGACGGCCTCGGCCAGCGCAGCGAATTCGGTTTCAACGACCTGCACCTGATGAGCTGGGAACAATCCCCG
CTCGGTCACGTCACCCGCTACGACTACGACGAGGTCGGCAACCTGCTGCGGGAAATCTCGCCCGCCGGGC
GGGTGGTCGAGTTCGGTTATCTCGATGACACCGGGCGGGTCAGCACCTTTACCGACGCCAGCGGCCACCA
GTGGCAGTACGACTACGACGACGCGCTGCGGCTGTGCGGCGTCACCGACCCGCTGGGCCGCGAGTGGGGC
TGGGTGTATGACGCCGAGGGTAACCCGGAGCGGCTCACCGGGCCGGATGCCAGCGAGGTCCGATTCACTT
GGAACCGCTACGGCCTGCTGACCCAGGTCAGTGACGCCGCCGGTGAGGTACAGGCGCGGTTGCAGTACGA
CCATCGCCAGCGGCTGCTGAGTGCCACTGACGCCGAGAGCCGCACCCGGCAGTTACGCTACGACGGGCAG
GACCGGGTGGTGCAGTGGCAACGGGCGGACGGTGCCCGTTTCCGGCTCGGCTACCGCCGGGCCAGCTGGA
CACTGCCGGAGCAGCTGATACGCCCGGACGACAAGGAAGAACTGCGCCAGTACGACCGCCACAACAACCT
GCTGAGCTACGTGGACGGCAACGGCGCGCTGTGGCGTCAGACCTTCGGCCCGTTCGACCTGCTGACCGCC
CGCACCGACGCCGAAGGCCGCACCTGGCACTACGCGTACGATAAAGAGAGCCAGCAACTGACAGCGGTTA
TTGCCCCGGACGGCAGCCGCTGGCAGTGGTGGCTGGATGCCGACGGGCGGGTCATCCGCGAGCGTGACAT
GACCGGCACCGAGACCCACTACAGCTACGACGAGGACGGCCTGTGCGTCAGCGTGCGCAACGGCGAAGGC
GACACCCGTCACTTCCTCTACGACGCCCGCGGCCTGCTGTTGCGTGAAACCGCGCCGGACGACACCCTGC
ACTACCGGTACGATGCGGTGGGCCGCCTGACCGAGGTCTCGTCAGCCACCGCCCATGTGCAACTGGACTA
CGACCTGTGCGACCGGGTGGTGCGTGAATGGCACAACGGCACGCTGCTCACCCGCCAGTACGATGACGCG
GCCCGCACCGTCACCCGCACCCTGACCTGGGACGGCGACGCCGATGACACCACCGGCACCCTCGCGCCGC
TCACCAGTCTGTTCCATTACACCCGCACCGGCGAGCTGCGGCAGGTGCAGTTGCCGGACGGTGCCGACCT
GACCCTGACCCATGACGCGGCGGGCCGCGAGTCACACCGTCGCGGCGGCAGCGGCTTTGTCCAGCAGCGG
GAATACGACGTGATGGGCTGGCTGACGCGGGAGATGAGCGGTGCACAGCACGACGGCCACCTGTTGGCGG
CACAGACGCGGGAATACCGCTACGACGGTGCCGGTAACCTGACCGGGGTGCGTCACAATCGCGACGCCGA
AGGTTATCGTCTGGACGCCACCGGCCGGGTGCAGGCAGTGCTGAGCGGCGGTGCGGGCAAACCGGTGGAC
ACCCTCGCCCGCTTCCACTACACCCGCAGCGGCCTGCCACAGGAGGCAGGCCGCCTCACCGAGTGGCAGT
CTGGCCGACTGGTGCAGCACGATGACACCCATTACCAGTACGACAGGGCCGGACGGCTCATCCGTAAACA
GGTGGTGCAGCCGGGCTACCGTCCGCAGGTGTGGCAGTACCGCTGGGACAGTCGCAACCAGCTGCGGGTG
GTGGATACCCCGACCGGCGAGCGCTGGCTGTACCGTTACGACCCGTTCGGTCGCCGGGTGGGCAAACGCT
GCGACCAGAAAGCCGAAGAAATTCGCTACCAGTGGGATGGCGACCAGATAGCGGAAATCCGCCACTACCG
CCACGGCCAGCTCGTGGCCCGTCGCCACTGGGTCTACAACGGCTGGGAGCTGGTGGTACAGCAGCGCCAG
CACACTGGCGGTGACTGGGAAACGGATTTTGTGACCAGCAGCCAGAACGGTACCCCACAGGCGCTGTTCA
CACCGGACGGCACCCTGCGCTGGCAGGCCCCGAAAGCCACGCTGTGGGGCCAGCGTCAGGCAGAAAAATC
GGAAAGTCCGGACCCCGGCCTGGCCTTCGCCGGGCAGCTCCGTGACAGCGAAAGCGGGCTGTGCTATAAC
CGCTTTCGGTACTACGACCCGGCCGGTGGGTGCTATGTCTCGCCTGACCCGATAGGGGTGCTGGGGGGGG
AGAGTAATTACGGGTATGTATACAACCCTATAAGCGGTATTGACCCTTTAGGTCTAAACGGTAAGAAATG
TATGGGTGTTAGTGAATCAGGTCATCACGTTCCATCCGTAAGAAAATCACAGGGAAGGCCTTTTGAGGTT
GCACGCTCCGATAAAACCCGCCCGACTTTATTTCCTAGGGGTAAAGAGCCAGAACATGATCATTGGCGAA
TGCATGATGCAGAAAGAAAATATGTAGGCCCAAGGCAAGGTGATTTTGCTGGTTCTGACAAAGAGTTGTT
TGATGCTTATAAGAAAGCGTATTCGAGTTTGGACGATATCAAAGTGGATGTTCGTTCTCCAAATGGTACA
CATATATTGGGTTCAAATGTAACACCGAGCCAAGCCGTAGACCTAATTGAAAACTGGCTTACCAAACAAG
GGTTGATGTAA