SecReT6
Effector Protein ID: 283787015
cts2H
SecReT6 ID375
T6SS typeA4a
Gene symbolcts2H
Locus tagROD_34191
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]3600351..3600836 [+]
ProductHcp family T6SS protein Cts2H
Effector typeProtein
Homologous effectorHcp
DescriptionHcp protein
UniProt IDD2TPU7
KEGG IDcro:ROD_34191
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.20E-38, Aligned region: 5..135
Protein Sequence: 161 a.a.     [Download]
>gi|283787015|ref|YP_003366880.1| cts2H gene product [Citrobacter rodentium ICC168]
MDAIFLKLEGIDGESLVKGFEKQLEIMSYSHNVAMQVTNDVSNTERTSGRAHVGEFSLTKFVDLSTPVLN
EYCCCGKVIPTAVLTLCRNDNGNMLPFIVYTLNNVIISQLNVSGGSGGKPVETMSLNFTKIKWEITAQKS
AGQKEGNSSSVWDMAMNQKGR
-
Nucleotide Sequence: 486 bp     [Download]
>gi|283783779|ref|NC_013716.1|:3600351-3600836 Citrobacter rodentium ICC168, complete genome
ATGGATGCAATTTTTTTAAAGCTGGAAGGCATTGATGGCGAGAGCTTGGTAAAAGGATTTGAGAAACAGC
TCGAGATCATGTCCTACAGCCATAACGTGGCGATGCAGGTGACGAACGACGTCAGTAACACCGAGCGCAC
CTCCGGGCGCGCCCATGTTGGCGAATTTTCTCTGACCAAGTTTGTCGATCTCTCTACCCCGGTGCTCAAC
GAATACTGCTGCTGCGGGAAGGTGATCCCCACGGCGGTACTGACGCTGTGCCGTAACGACAATGGCAATA
TGCTGCCGTTTATTGTCTACACCTTAAACAATGTCATTATTTCTCAGCTCAACGTCAGCGGCGGATCCGG
CGGTAAGCCAGTGGAGACAATGTCGCTGAACTTCACCAAAATCAAATGGGAGATCACCGCTCAGAAATCG
GCCGGGCAAAAAGAGGGTAACTCTTCTTCCGTTTGGGATATGGCGATGAACCAGAAAGGGCGTTGA