SecReT6
Effector Protein ID: 283787382
ctsH1
SecReT6 ID375
T6SS typeA4a
Gene symbolctsH1
Locus tagROD_38091
StrainCitrobacter rodentium ICC168
Repliconchromosome [GenBank: NC_013716] [Browse all T6SS(s) in this replicon]
Location [Strand]4016006..4016491 [+]
ProductHcp family T6SS protein CtsH1
Effector typeProtein
Homologous effectorHcp
DescriptionHcp protein
UniProt IDD2TTL3
KEGG IDcro:ROD_38091
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.10E-31, Aligned region: 7..145
Protein Sequence: 161 a.a.     [Download]
>gi|283787382|ref|YP_003367247.1| ctsH1 gene product [Citrobacter rodentium ICC168]
MAVPVHLWLKDDSGAIIRGSSDVRDREGSIELRGLTHNLCIPTDSATGKLTGTRRHAPLLFDKEIDSSSP
YLYKAVATGQTLKSAELKFYHINDAGQEVEYFIILLEEVKVVSITPVVHDTRTVTGTGHLESVQLRYEKI
TWLYKDGNIQYADAWNERASA
-
Nucleotide Sequence: 486 bp     [Download]
>gi|283783779|ref|NC_013716.1|:4016006-4016491 Citrobacter rodentium ICC168, complete genome
ATGGCAGTTCCTGTTCACTTATGGCTTAAAGATGATAGCGGCGCGATTATCCGCGGCTCTTCTGATGTCC
GGGATCGCGAAGGCAGTATAGAGCTACGTGGTTTAACGCATAATCTCTGCATCCCCACCGATAGCGCGAC
AGGGAAACTCACGGGTACACGCAGACATGCGCCTTTATTGTTTGATAAGGAGATCGATTCCTCTTCCCCC
TATCTTTACAAAGCTGTCGCAACGGGCCAGACGCTGAAGAGCGCGGAACTGAAGTTTTATCATATCAATG
ATGCGGGGCAAGAAGTTGAATACTTTATTATTCTTCTTGAAGAGGTGAAAGTCGTATCCATAACCCCTGT
TGTGCATGATACCCGGACGGTAACTGGCACCGGGCATCTGGAAAGCGTGCAGTTGCGCTACGAAAAAATT
ACCTGGCTATATAAAGACGGCAATATCCAGTATGCTGACGCATGGAACGAAAGAGCGTCAGCGTAG