SecReT6
Effector Protein ID: 28898162
-
SecReT6 ID43
T6SS typeA1
Gene symbol-
Locus tagVP1388
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome I [GenBank: NC_004603] [Browse all T6SS(s) in this replicon]
Location [Strand]1483439..1485205 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVP1388
DescriptionVP1388
UniProt IDQ87PW2
KEGG IDvpa:VP1388
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 588 a.a.     [Download]
>gi|28898162|ref|NP_797767.1| hypothetical protein VP1388 [Vibrio parahaemolyticus RIMD 2210633]
MWRIQMHLVCKFIPSSKLSSNELSYVLTPDECIGQLSRVRNSEDILRNLPKELAQKISISAKKSSSGLLT
AIRHELGNGNWVALSSFSRRTPLTDTQLQSFPRLKAQLESVSSTGESKVYKAGYKQVKDDVTLVRSYTHV
PSEPSPDQKIVVEFAGQWSSNAACLMLGKTEAQKEKVTVGKADTENKHRSLATFKDLEAEGKTLYIKIPC
SDQPQPILLKLAEDLQPVDKETQMDEWDNVLVPVVPLHFPGSDKSDEAAEVFKSGYVYVVWNNKIWREVA
ITENGYFSDTDINSVREGSRPKRHADIYMTNPETGGVFAYEPFQIVQNGKVVSEGSLNGSGEARVFNLVE
EEVEIVMTGYEPQIKEKIETNLSPINASSPVGRSAQGYPLPHIWLPYKIKGEPQEVYLAYNSKRLSESEL
SELESDPGTKAIKVTDLNHYSSEKSFKMGDGSVRLLSVLPSAATSKPEKYAMLRSQINKNVAVVYLLKSV
EIVFEYPGYTTLDESDDYFELRQSDGDWSQRVCLRQCIKKENGSRLIRFTGWPAEVKEVDLLRGYQGNSH
HGRDNKTVIFAQTPIADLLAYKKKDQPS
-
Nucleotide Sequence: 1767 bp     [Download]
>gi|28896774|ref|NC_004603.1|:1483439-1485205 Vibrio parahaemolyticus RIMD 2210633 chromosome 1, complete sequence
TTGTGGAGAATTCAAATGCATTTAGTTTGCAAATTTATACCTAGCTCGAAGCTTTCCTCCAACGAGCTAT
CCTACGTCCTTACACCTGATGAGTGTATAGGGCAGCTTTCGCGTGTGCGAAATTCAGAAGACATTCTCAG
AAACCTTCCTAAAGAGCTTGCTCAGAAGATCTCAATCTCTGCCAAGAAGTCTAGCTCCGGGTTGCTAACG
GCTATTCGACACGAGCTAGGAAATGGGAACTGGGTTGCGTTGTCTTCTTTCTCTCGTAGAACGCCGTTAA
CAGATACCCAATTACAAAGTTTCCCAAGACTAAAAGCACAGCTTGAATCGGTCTCATCGACTGGTGAGAG
CAAAGTTTATAAAGCGGGTTATAAGCAGGTAAAGGACGACGTGACTTTGGTTCGTAGCTACACGCATGTC
CCTTCTGAGCCAAGTCCAGACCAAAAAATCGTTGTCGAGTTTGCAGGGCAGTGGTCTAGCAACGCGGCAT
GTTTGATGTTGGGAAAAACCGAAGCTCAAAAAGAAAAAGTTACTGTAGGCAAGGCTGATACAGAAAACAA
ACACCGCAGCCTCGCGACATTTAAAGATCTCGAAGCTGAGGGCAAAACGCTCTATATCAAAATCCCTTGT
TCCGACCAGCCTCAGCCAATCTTGCTTAAACTCGCCGAAGACCTGCAACCCGTTGATAAAGAAACTCAAA
TGGATGAGTGGGATAACGTGTTGGTGCCTGTGGTTCCGCTGCACTTCCCTGGTAGCGATAAATCAGATGA
AGCTGCAGAAGTGTTTAAGTCAGGCTACGTGTATGTTGTTTGGAACAATAAAATTTGGCGCGAAGTGGCA
ATTACGGAAAATGGTTACTTTTCAGATACGGACATTAATAGTGTTCGTGAAGGCTCTAGACCCAAAAGGC
ACGCCGATATCTATATGACCAATCCTGAAACAGGCGGTGTTTTCGCTTATGAGCCTTTCCAAATCGTGCA
GAACGGCAAGGTGGTAAGTGAAGGCTCTTTGAATGGCTCTGGAGAGGCTCGAGTGTTCAACTTAGTTGAG
GAAGAAGTTGAGATAGTCATGACCGGCTATGAGCCACAAATCAAAGAAAAGATTGAAACAAATTTGAGCC
CTATTAATGCTTCTAGCCCAGTGGGGCGGAGCGCGCAAGGTTACCCTCTCCCGCATATATGGCTTCCTTA
CAAGATTAAAGGTGAGCCTCAAGAAGTATATTTGGCTTATAACAGTAAACGATTGAGCGAGAGTGAACTA
TCTGAACTAGAAAGTGATCCCGGAACCAAGGCCATAAAAGTCACTGATCTTAACCATTACAGCAGTGAGA
AAAGCTTTAAAATGGGAGACGGTTCTGTTCGTCTGCTCTCAGTATTACCAAGTGCTGCGACCTCAAAACC
TGAAAAATACGCAATGTTACGAAGCCAGATAAATAAAAATGTAGCGGTCGTGTATTTACTTAAATCTGTC
GAGATAGTTTTCGAATATCCGGGCTATACGACGCTGGACGAGTCAGATGATTACTTTGAGTTAAGGCAAA
GCGATGGTGATTGGTCGCAGCGAGTGTGCTTGCGCCAATGTATAAAAAAAGAGAATGGTTCTAGGTTGAT
TCGTTTTACTGGTTGGCCTGCAGAGGTTAAAGAAGTGGATCTTCTCCGTGGTTATCAGGGCAATAGTCAT
CACGGAAGAGATAATAAAACGGTCATTTTTGCTCAAACACCCATTGCGGATTTACTGGCTTATAAGAAAA
AAGATCAGCCAAGTTAA

Reference
(1) Salomon D et al. (2014). Marker for type VI secretion system effectors. Proc Natl Acad Sci U S A. 111(25):9271-6. [PudMed:24927539] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature