SecReT6
Effector Protein ID: 28898167
-
SecReT6 ID43
T6SS typeA1
Gene symbol-
Locus tagVP1393
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome I [GenBank: NC_004603] [Browse all T6SS(s) in this replicon]
Location [Strand]1495971..1496489 [+]
ProductBfdA protein
Effector typeProtein
Homologous effectorVP1393
DescriptionHcp protein
UniProt IDQ79YY3
KEGG IDvpa:VP1393
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.30E-35, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|28898167|ref|NP_797772.1| BfdA protein [Vibrio parahaemolyticus RIMD 2210633]
MPTPAYMSINGETQGHITKDTYSADSVGNTWQEAHVDEFLVQELDHVLTVPRDPQSGQPTGQRVHRPLVV
TKVQDRSSPLLFNALVSGEKLPECLIRFYRTSVQGKQEHYYSIKLIDALLVDIQTRMNHCQDAATADRVT
EEVLKFTYRAIEVTHENCGTAGNDDWRAPREA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|28896774|ref|NC_004603.1|:1495971-1496489 Vibrio parahaemolyticus RIMD 2210633 chromosome 1, complete sequence
ATGCCAACTCCAGCATATATGTCTATCAACGGTGAAACTCAAGGTCACATTACTAAAGATACATACTCTG
CAGATTCAGTAGGTAACACATGGCAAGAAGCTCACGTTGATGAGTTCCTAGTACAAGAACTTGATCACGT
GCTAACTGTTCCACGTGATCCACAAAGTGGTCAACCTACTGGTCAACGTGTACACCGTCCACTTGTTGTG
ACTAAAGTTCAAGACCGTTCTTCTCCACTACTATTTAACGCACTAGTGTCTGGTGAAAAACTTCCTGAGT
GTTTGATTCGTTTCTACCGTACTTCAGTTCAAGGCAAGCAAGAGCACTACTACTCAATCAAGCTGATTGA
TGCGCTATTGGTAGATATCCAAACTCGTATGAACCACTGTCAAGATGCAGCAACAGCTGATCGCGTTACA
GAAGAAGTTCTTAAGTTTACTTACCGTGCAATCGAAGTAACTCACGAAAACTGTGGTACAGCTGGTAACG
ACGACTGGCGTGCTCCACGCGAAGCATAA

Reference
(1) Salomon D et al. (2013). Vibrio parahaemolyticus Type VI Secretion System 1 Is Activated in Marine Conditions to Target Bacteria, and Is Differentially Regulated from System 2. PLoS One. 8(4):e61086. [PudMed:23613791] experimental
 
experimental experimental literature