SecReT6
Effector Protein ID: 28901118
-
SecReT6 ID43
T6SS typeA1
Gene symbol-
Locus tagVPA1263
StrainVibrio parahaemolyticus RIMD 2210633
Repliconchromosome I [GenBank: NC_004605] [Browse all T6SS(s) in this replicon]
Location [Strand]1341842..1344451 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorVPA1263
DescriptionVPA1263
UniProt IDQ87GQ2
KEGG IDvpa:VPA1263
PDB IDNA
Domain hit(s) vs Pfam Colicin-DNase [PF12639], Evalue: 5.80E-32, Aligned region: 738..867
Pyocin_S [PF06958], Evalue: 5.20E-30, Aligned region: 601..734
LysM [PF01476], Evalue: 0.0078, Aligned region: 370..414
Protein Sequence: 869 a.a.     [Download]
>gi|28901118|ref|NP_800773.1| hypothetical protein VPA1263 [Vibrio parahaemolyticus RIMD 2210633]
MSYKVLPLSEVMSHEFGLIEGNFHNISEADIASAIPSHLTFEQLKQHLYEGNLALVSDTPQTPALLSYND
PIGPKTWRLNSEVISELSDDAANNLLAITKTTRATGGYRSCIGETSTLERVYTPQPIATESEEEITKEFE
YSFEVGCSDATIKKMVHSDFALAKTEKENAVTRWEQTNTEQGTRYTALCVFDEPKRLNIHIADDNLGLTP
LEAVTLQKAGSCKTDEGFIPVVPAVRLGERLGLPTEGYYYHFNDGELVQEYKILGEEKWAFYATQSTQDK
LNDERGFTKDQSAILVYWKLADQIIENQYIIYLERQITREELDNLSEDWLCENGIKLDIPALFDAVKQPE
EARSEGNNDETQAEQTAATHTVTVGEDWQSIAELYGMGAKALLLLNPVFEADPLSLAVGDEIIVAEKQQQ
QAPDKKNTFPPLRPQTYNNIRNSHYQHSDPLLGLTKYRAINTADCIEGDVVILNLKDATSSIVFAKSCTR
PEGCIEIGDQQESISNFGPWSFFFAQANANPAAVIPAIQATQAQMAMGSSAAVAGSPEQMQQTQTAAMQL
DKLAGTLKEKIVEGYRWQVEGIGALFAMQQSLFGDNTQYTDQDLRQVTTAQSRVRVHITEPQGGEFYPHV
QGYHVDDTRIPIKYVKQGNNGQLSVAIEENGPTIYWTPEENGEASWQTTPDHSDGFEKDDILVTPIHSDS
DANVTVTPAPEEKDWRDAILVFPESSGIAPLYVVYKESPRDKPGVVTGKGEDIFGIWLADAGKDLGAPIP
SQIADKLRGREFSSFDAFREGFWYAVGEDQTLINQFSRANQRLIKRGRSPFSLPSEQVGGRQRYELHHKE
EIQYGGEVFHVDNLCVLTPKRHISIHKDQ
-
Nucleotide Sequence: 2610 bp     [Download]
>gi|28899855|ref|NC_004605.1|:1341842-1344451 Vibrio parahaemolyticus RIMD 2210633 chromosome 2, complete sequence
GTGTCCTATAAAGTTCTTCCACTGTCGGAAGTAATGTCTCATGAATTTGGATTGATAGAGGGCAACTTCC
ATAATATTTCGGAAGCGGATATCGCCTCTGCTATTCCTTCACATCTTACTTTTGAACAACTAAAGCAGCA
TCTCTACGAAGGTAATCTCGCACTCGTTAGTGATACGCCTCAAACTCCTGCTCTGCTTAGTTACAACGAC
CCAATAGGTCCTAAAACTTGGCGGCTGAATTCTGAGGTTATCTCTGAACTTTCGGATGATGCGGCTAATA
ATTTGTTAGCAATAACGAAAACCACCAGAGCAACGGGAGGTTACCGCTCTTGTATCGGGGAAACCTCGAC
GCTCGAACGAGTTTACACGCCGCAGCCAATCGCAACCGAAAGTGAAGAGGAAATCACCAAGGAATTTGAG
TACAGCTTTGAAGTTGGCTGCTCGGATGCCACCATAAAGAAAATGGTGCACAGTGACTTTGCTTTAGCGA
AAACTGAAAAAGAGAACGCGGTAACCCGCTGGGAACAAACCAATACCGAGCAAGGCACCCGCTACACTGC
GTTATGTGTATTTGATGAGCCAAAGCGTTTAAATATCCACATAGCTGATGACAATCTCGGGCTGACGCCA
CTGGAAGCCGTCACATTACAAAAAGCCGGCAGCTGTAAAACGGACGAAGGTTTTATACCTGTTGTCCCTG
CAGTGCGATTGGGCGAACGTTTAGGTTTGCCTACAGAAGGTTATTACTACCACTTTAATGATGGCGAACT
TGTCCAAGAATACAAAATTCTAGGAGAAGAAAAGTGGGCGTTTTACGCAACGCAATCGACACAAGACAAG
CTCAATGATGAGCGTGGTTTTACCAAAGACCAAAGCGCAATTTTGGTGTATTGGAAATTAGCTGATCAAA
TCATCGAGAATCAATACATCATTTATCTTGAGCGCCAAATCACCCGAGAAGAGCTTGATAATCTAAGTGA
AGATTGGCTGTGTGAAAACGGGATAAAGTTGGATATCCCCGCATTGTTTGATGCGGTCAAACAGCCGGAA
GAAGCGCGCTCAGAAGGTAACAACGATGAGACGCAAGCGGAACAAACCGCAGCGACGCACACCGTAACGG
TAGGGGAAGACTGGCAAAGCATCGCTGAACTATATGGTATGGGAGCTAAAGCCTTGCTCTTGCTTAACCC
AGTGTTTGAGGCCGACCCTCTGTCACTTGCGGTAGGTGATGAAATTATTGTTGCTGAGAAACAGCAACAA
CAAGCACCGGACAAAAAGAATACCTTTCCGCCGCTGCGCCCACAAACTTACAACAACATCCGCAACAGTC
ATTATCAGCACAGTGATCCATTGCTCGGGTTGACCAAATATAGAGCCATTAACACTGCCGATTGCATAGA
AGGCGATGTGGTAATCCTCAATTTAAAAGACGCCACAAGCTCGATCGTGTTCGCTAAATCCTGCACCAGA
CCAGAGGGATGTATTGAAATTGGCGACCAACAAGAGTCAATAAGTAACTTTGGTCCTTGGTCATTCTTCT
TTGCACAAGCCAATGCAAACCCAGCTGCTGTCATACCCGCCATTCAAGCGACACAAGCACAAATGGCTAT
GGGCAGTTCCGCAGCTGTCGCCGGTTCCCCAGAGCAAATGCAGCAAACCCAAACCGCAGCGATGCAGTTA
GATAAACTGGCCGGCACATTGAAAGAAAAAATCGTCGAGGGCTACCGCTGGCAGGTCGAAGGTATTGGCG
CTTTGTTTGCCATGCAGCAAAGCTTATTTGGCGATAACACCCAATACACAGACCAAGATTTACGCCAAGT
AACCACGGCGCAAAGCCGCGTTCGTGTCCACATTACCGAGCCCCAAGGTGGTGAGTTTTATCCGCACGTA
CAGGGCTATCATGTAGATGACACACGAATCCCCATCAAATATGTGAAACAAGGGAACAATGGTCAGTTGT
CCGTTGCGATTGAAGAGAACGGACCAACCATCTATTGGACACCAGAAGAAAACGGTGAAGCAAGTTGGCA
AACTACCCCCGATCATAGTGATGGGTTTGAAAAAGACGATATACTTGTCACGCCAATTCACTCGGATAGT
GATGCAAACGTCACCGTTACGCCTGCGCCAGAAGAGAAAGACTGGCGCGATGCGATCTTGGTATTCCCTG
AAAGCTCAGGTATTGCTCCGCTCTATGTGGTTTACAAAGAAAGCCCGAGAGATAAGCCCGGAGTAGTTAC
TGGTAAGGGCGAAGATATCTTTGGTATCTGGTTAGCTGATGCGGGTAAAGACTTGGGTGCTCCAATACCT
TCCCAAATTGCTGATAAGCTAAGAGGAAGAGAGTTCAGTAGCTTTGATGCATTTAGAGAAGGCTTTTGGT
ACGCCGTTGGTGAAGACCAAACTTTAATCAACCAGTTCAGCCGTGCGAATCAACGTTTGATCAAGAGAGG
CCGTTCTCCTTTTTCGCTACCAAGTGAACAAGTTGGAGGGAGACAAAGGTATGAGTTACACCACAAAGAA
GAGATACAGTATGGTGGAGAAGTATTCCATGTAGATAATTTATGTGTCCTTACCCCGAAACGACATATCA
GCATACATAAGGATCAATAA

Reference
(1) Salomon D et al. (2014). Marker for type VI secretion system effectors. Proc Natl Acad Sci U S A. 111(25):9271-6. [PudMed:24927539] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature