SecReT6
Effector Protein ID: 29142962
-
SecReT6 ID45
T6SS typeA3
Gene symbol-
Locus tagt2586
StrainSalmonella enterica subsp. enterica serovar Typhi str. Ty2
Repliconchromosome [GenBank: NC_004631] [Browse all T6SS(s) in this replicon]
Location [Strand]2665434..2665835 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorSTY0300
DescriptionTae2_TY
UniProt IDQ8Z969
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 133 a.a.     [Download]
>gi|29142962|ref|NP_806304.1| hypothetical protein t2586 [Salmonella enterica subsp. enterica serovar Typhi str. Ty2]
MPYVYANAKALQDTEKVGNHHQCVELIQHYIRVGQASTWQQGAAVFGNKNIEVGTVIATFVNGRYPNHNS
GNHAAFFLGQDTGGIWVMDQWKDDIAKPRVSKRYIRKLHNGSVRSDGTYIRMSNNAEAYFIVE
-
Nucleotide Sequence: 402 bp     [Download]
>gi|29140543|ref|NC_004631.1|:c2665835-2665434 Salmonella enterica subsp. enterica serovar Typhi str. Ty2 chromosome, complete genome
ATGCCATATGTTTATGCTAATGCAAAGGCTTTACAGGATACAGAAAAGGTAGGAAACCACCATCAGTGTG
TTGAACTTATTCAACACTATATACGAGTAGGACAAGCGAGTACATGGCAGCAAGGGGCCGCAGTATTTGG
AAACAAAAACATTGAAGTCGGGACAGTTATCGCTACTTTTGTGAATGGGCGATATCCGAACCACAATAGT
GGCAACCATGCTGCATTTTTTTTGGGGCAAGATACTGGCGGGATATGGGTGATGGATCAATGGAAAGATG
ATATCGCAAAACCCCGTGTGTCCAAACGTTATATAAGAAAGTTGCATAATGGAAGTGTTCGTAGTGACGG
GACTTATATAAGGATGAGTAATAATGCAGAAGCCTATTTTATCGTTGAATAG