SecReT6
Effector Protein ID: 291619699
SecReT6 ID385
T6SS typeA2
Gene symbol-
Locus tagPANA_4146
StrainPantoea ananatis LMG 20103
Repliconchromosome [GenBank: NC_013956] [Browse all T6SS(s) in this replicon]
Location [Strand]4606548..4607075 [-]
Producthypothetical Protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDD4GFJ3
KEGG IDpam:PANA_4146
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.80E-36, Aligned region: 18..159
Protein Sequence: 175 a.a.     [Download]
>gi|291619699|ref|YP_003522441.1| hypothetical Protein PANA_4146 [Pantoea ananatis LMG 20103]
MMAHHNTMESNFMAIPVYLWLQDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHTP
FLFTKEIDSSSPYLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPVMHDIKDPSFEK
HNHLERIELRYEKITWTYKDGNIIHSDSWNERATA
-
Nucleotide Sequence: 528 bp     [Download]
>gi|332139403|ref|NC_013956.2|:c4607075-4606548 Pantoea ananatis LMG 20103 chromosome, complete genome
ATGATGGCGCATCACAACACAATGGAGAGTAATTTCATGGCAATTCCTGTTTATCTCTGGCTACAAGACG
ACGGCGGCGCGGACATCAAGGGTTCGGTTGACGTTCAGGATCGTGAAGGCAGCATCGAAGTGGTCGCGCA
GGAGCACAACCTGTACATCCCGACCGATAACAACACCGGCAAGCTGACCGGCACCCGTATTCATACGCCG
TTCCTGTTCACCAAGGAAATCGATTCGTCCAGCCCGTATCTCTACAAGGCGGTAACCACCGGTCAGACCC
TCAAGTCTGCGGAATTCAAATGGTACAAAATCAACGATGCGGGTCAGGAAGTGGAGTACTTCAACACCAA
ACTGGAAAACGTGAAGGTGGTGAAGGTGAACCCCGTGATGCATGACATCAAAGATCCTTCTTTTGAGAAG
CACAACCACCTTGAGCGCATCGAACTGCGTTACGAAAAAATCACCTGGACCTATAAAGACGGCAACATCA
TCCATTCCGATTCCTGGAACGAACGCGCTACCGCGTAA