SecReT6
Effector Protein ID: 292489485
-
SecReT6 ID386
T6SS typeA3
Gene symbol-
Locus tagEAMY_3018
StrainErwinia amylovora CFBP1430
Repliconchromosome [GenBank: NC_013961] [Browse all T6SS(s) in this replicon]
Location [Strand]3123241..3123720 [-]
Producttype VI secretion system-associated protein
Effector typeProtein
Homologous effectorSMA2264
DescriptionSsp2
UniProt IDD4I0Q7
KEGG IDeam:EAMY_3018
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 7.30E-29, Aligned region: 46..156
Protein Sequence: 159 a.a.     [Download]
>gi|292489485|ref|YP_003532373.1| unnamed protein product [Erwinia amylovora CFBP1430]
MAIRPAFLQAWQRFSEINIDVSSVGKKIGGNVGANIMLGEQDPSQGFTNACAIRMSYTLNYSGARVERGV
WKTVSGDDKNWYIYRVKDLLTYMHKKYGKPDKIVKNPTPGDFQNLKGILVFAVNGWSDASGHATLWNGSV
CSDHCYFPISNEGSIWLLK
-
Nucleotide Sequence: 480 bp     [Download]
>gi|292486492|ref|NC_013961.1|:c3123720-3123241 Erwinia amylovora CFBP1430 chromosome, complete genome
ATGGCAATAAGACCCGCTTTTTTACAGGCATGGCAGCGCTTCAGTGAGATAAATATCGATGTTTCATCCG
TTGGGAAAAAGATAGGTGGAAATGTCGGTGCAAATATCATGCTAGGTGAACAGGACCCCTCACAGGGATT
TACCAATGCGTGCGCGATAAGAATGAGTTACACGTTAAACTACTCTGGGGCTAGAGTCGAAAGAGGCGTC
TGGAAAACGGTTTCAGGGGATGATAAAAATTGGTACATATATCGGGTAAAAGATCTGTTGACGTATATGC
ATAAAAAATACGGTAAACCTGACAAGATAGTAAAAAACCCAACGCCCGGTGATTTTCAGAATCTGAAAGG
AATATTGGTGTTTGCAGTGAATGGCTGGAGTGATGCTAGCGGGCATGCAACTTTATGGAATGGATCGGTT
TGCTCCGATCACTGTTATTTCCCAATCTCGAATGAGGGTTCTATATGGTTATTAAAATAG