SecReT6
Effector Protein ID: 292898098
SecReT6 ID388
T6SS typeA2
Gene symbol-
Locus tagEAM_0372
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]451842..452333 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDD4IE24
KEGG IDeay:EAM_0372
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 5.50E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|292898098|ref|YP_003537467.1| hypothetical protein EAM_0372 [Erwinia amylovora ATCC 49946]
MAIPIYLWLKDDGGAAIKGSVNVKDREGSIEVLSQDHSLYMPTDNNTGKLTGTRIHTPFQFSKEIDSSSP
YLYRAVTSGKKLKSAEFKWYRINDAGQEVEYFNTRLEDVKLVKVAPKMHDIKDPTKEKHNHLEIIELRYE
KITWTYKDGNIIYSDSWDDRPSA
-
Nucleotide Sequence: 492 bp     [Download]
>ref|NC_013971.1|:451842-452333 hypothetical protein EAM_0372 [Erwinia amylovora ATCC 49946]
ATGGCAATTCCAATTTATCTATGGCTGAAAGACGACGGCGGCGCGGCCATTAAAGGCTCCGTAAATGTTA
AAGACCGTGAGGGCAGCATCGAAGTTCTCTCGCAGGATCATAGCCTGTATATGCCAACCGATAACAATAC
CGGCAAACTGACGGGCACCCGCATTCATACCCCGTTCCAGTTTAGCAAAGAAATCGATTCCTCCAGCCCG
TACCTGTACAGAGCGGTAACCTCTGGCAAAAAGCTGAAGTCTGCCGAGTTCAAGTGGTACAGAATCAACG
ATGCGGGTCAGGAAGTGGAGTATTTCAATACCCGACTTGAGGACGTCAAGCTGGTAAAGGTCGCGCCAAA
AATGCACGACATTAAAGACCCGACCAAAGAGAAGCATAATCACCTCGAAATCATCGAGCTGCGTTATGAA
AAAATCACCTGGACCTATAAAGACGGCAACATCATTTATTCCGATTCCTGGGACGATCGCCCCAGCGCGT
AA