SecReT6
Effector Protein ID: 292898303
-
SecReT6 ID389
T6SS typeA3
Gene symbol-
Locus tagEAM_0581
StrainErwinia amylovora ATCC 49946
Repliconchromosome [GenBank: NC_013971] [Browse all T6SS(s) in this replicon]
Location [Strand]647662..648141 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorSMA2264
DescriptionSsp2
UniProt IDD4IFS9
KEGG IDeay:EAM_0581
PDB IDNA
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 7.30E-29, Aligned region: 46..156
Protein Sequence: 159 a.a.     [Download]
>gi|292898303|ref|YP_003537672.1| hypothetical protein EAM_0581 [Erwinia amylovora ATCC 49946]
MAIRPAFLQAWQRFSEINIDVSSVGKKIGGNVGANIMLGEQDPSQGFTNACAIRMSYTLNYSGARVERGV
WKTVSGDDKNWYIYRVKDLLTYMHKKYGKPDKIVKNPTPGDFQNLKGILVFAVNGWSDASGHATLWNGSV
CSDHCYFPISNEGSIWLLK
-
Nucleotide Sequence: 480 bp     [Download]
>ref|NC_013971.1|:647662-648141 hypothetical protein EAM_0581 [Erwinia amylovora ATCC 49946]
ATGGCAATAAGACCCGCTTTTTTACAGGCATGGCAGCGCTTCAGTGAGATAAATATCGATGTTTCATCCG
TTGGGAAAAAGATAGGTGGAAATGTCGGTGCAAATATCATGCTAGGTGAACAGGACCCCTCACAGGGATT
TACCAATGCGTGCGCGATAAGAATGAGTTACACGTTAAACTACTCTGGGGCTAGAGTCGAAAGAGGCGTC
TGGAAAACGGTTTCAGGGGATGATAAAAATTGGTACATATATCGGGTAAAAGATCTGTTGACGTATATGC
ATAAAAAATACGGTAAACCTGACAAGATAGTAAAAAACCCAACGCCCGGTGATTTTCAGAATCTGAAAGG
AATATTGGTGTTTGCAGTGAATGGCTGGAGTGATGCTAGCGGGCATGCAACTTTATGGAATGGATCGGTT
TGCTCCGATCACTGTTATTTCCCAATCTCGAATGAGGGTTCTATATGGTTATTAAAATAG