SecReT6
Effector Protein ID: 294502597
-
SecReT6 ID390
T6SS typeA3
Gene symbol-
Locus tagYPZ3_0487
StrainYersinia pestis Z176003
Repliconchromosome [GenBank: NC_014029] [Browse all T6SS(s) in this replicon]
Location [Strand]589453..589971 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorYPK_3563
DescriptionHcp protein
UniProt IDD5B0D6
KEGG IDypz:YPZ3_0487
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.60E-33, Aligned region: 8..148
Protein Sequence: 172 a.a.     [Download]
>gi|294502597|ref|YP_003566659.1| hypothetical protein YPZ3_0487 [Yersinia pestis Z176003]
MAALVDYFLHIEGVDGESPDQQYNGWIQVQAWQWAEENAGRWGLGGGGGSGKVEMKDFEFRMVSNKASPK
LFLMCAIGEHIPQAKLVCRKSGQGQQDFLIVTFSNCLVSSFKTVGNMPLGKGDAVFTDTVLPTDAISLNF
ARIEVEYKEQQPDGSMGAVIKAGYDLKLNSRI
-
Nucleotide Sequence: 519 bp     [Download]
>gi|294502110|ref|NC_014029.1|:589453-589971 Yersinia pestis Z176003 chromosome, complete genome
ATGGCAGCTTTAGTCGATTACTTTCTCCATATCGAAGGTGTAGATGGTGAGTCTCCCGATCAGCAGTATA
ACGGATGGATCCAAGTACAGGCTTGGCAATGGGCGGAGGAGAATGCGGGGCGCTGGGGGCTAGGTGGCGG
TGGTGGTTCTGGGAAAGTCGAAATGAAGGACTTCGAATTTCGCATGGTGAGTAACAAAGCATCACCAAAA
CTATTTTTGATGTGTGCCATCGGTGAACACATTCCGCAGGCCAAGTTGGTGTGTCGTAAATCAGGTCAAG
GTCAACAAGACTTCCTGATTGTTACCTTCAGTAACTGTCTGGTGTCCTCCTTTAAAACTGTCGGCAACAT
GCCTCTTGGTAAAGGGGACGCAGTATTCACCGACACGGTGCTGCCAACGGATGCCATCAGCCTTAACTTT
GCACGTATCGAAGTGGAATACAAAGAGCAGCAACCTGATGGCTCGATGGGGGCCGTGATTAAGGCTGGTT
ACGATCTGAAATTGAACAGCCGTATTTAA