SecReT6
Effector Protein ID: 296101741
-
SecReT6 ID395
T6SS typeA3
Gene symbol-
Locus tagECL_01377
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1397170..1397652 [-]
ProductHcp family type VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDD5C5K7
KEGG IDenc:ECL_01377
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.70E-35, Aligned region: 6..146
Protein Sequence: 160 a.a.     [Download]
>gi|296101741|ref|YP_003611887.1| Hcp family type VI secretion system effector [Enterobacter cloacae subsp. cloacae ATCC 13047]
MAIPAYLWLKDDGGANITGSVDVQHREGSIEVLGFGHGLHLPTDSATGKITGTRVHSALNFEKEFDSSSP
YLYKAVAHGQTLQSAEFKWYRINDAGQEVEYFNMYLEGVKVVSVCPVMHDVKDPTTEKHNHLESISLRYE
RITWKHCDGNIIFTDSWADR
-
Nucleotide Sequence: 483 bp     [Download]
>gi|296100371|ref|NC_014121.1|:c1397652-1397170 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGGCTATACCCGCATATCTTTGGCTTAAAGATGACGGCGGTGCAAACATTACAGGTTCTGTAGATGTTC
AGCACCGTGAAGGTAGTATTGAAGTTCTTGGATTTGGACATGGTTTGCACCTTCCTACTGATAGCGCAAC
CGGAAAAATCACAGGTACACGAGTTCACTCCGCATTAAATTTTGAAAAAGAATTCGATTCATCAAGCCCA
TATCTTTATAAAGCTGTGGCGCATGGGCAAACGTTACAATCAGCGGAATTTAAGTGGTACAGAATTAACG
ACGCTGGGCAGGAAGTTGAATACTTCAATATGTATCTTGAAGGGGTAAAGGTAGTGTCTGTATGCCCCGT
CATGCACGATGTGAAAGATCCTACGACTGAAAAGCACAACCATCTTGAAAGCATATCTTTGCGTTATGAA
CGCATAACCTGGAAGCACTGCGACGGCAATATTATTTTTACTGATTCTTGGGCAGACAGATGA