SecReT6
Effector Protein ID: 296101903
hcp
SecReT6 ID395
T6SS typeA3
Gene symbolhcp
Locus tagECL_01541
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1562931..1563413 [+]
Producttype VI secretion system secreted protein Hcp
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDD5C6F5
KEGG IDenc:ECL_01541
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-38, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|296101903|ref|YP_003612049.1| type VI secretion system secreted protein Hcp [Enterobacter cloacae subsp. cloacae ATCC 13047]
MAIDMFLKVEGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTAIL
KHCASGKHLTKVELSVCKAGGQQVEYSRITLEDVLVTSVQYTGADNGDTVGVTYAFQAAKVKQQYWEQTT
SGGKGAESSAGWNIKENKEA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1562931-1563413 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGGCTATTGATATGTTTCTGAAGGTCGAGGGTGTTACGGGCGAATCTAAAGATTCTAACCACACCGGCT
GGACTGATATTACCTCCTTCTCCTGGGGCGCTTCCCAGCCAGGTAATATGAGCGTTGGCGGTGGCGGCGG
TGCCGGTAAAGTTAACTTTAACGATCTGCACGTTAACGCTCTGATCGACAAATCCACCACAGCAATTCTG
AAACACTGCGCCAGCGGTAAACACCTGACCAAAGTTGAGCTGTCCGTCTGTAAAGCCGGTGGCCAGCAGG
TGGAATACTCTCGCATTACCCTGGAAGACGTTCTGGTAACGTCTGTTCAGTACACCGGTGCAGACAACGG
CGATACCGTTGGTGTGACCTATGCATTCCAGGCTGCGAAAGTGAAACAGCAGTACTGGGAGCAGACCACC
TCTGGTGGTAAAGGTGCTGAAAGCAGCGCTGGCTGGAACATCAAAGAAAACAAAGAAGCATAA