SecReT6
Effector Protein ID: 296101904
-
SecReT6 ID395
T6SS typeA3
Gene symbol-
Locus tagECL_01542
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1563472..1563963 [+]
Productputative cytoplasmic protein
Effector typeProtein
Homologous effectorECL_01542
DescriptionTae4_EC
UniProt IDD5C6F6
KEGG IDenc:ECL_01542
PDB ID4HFK, 4HFL
Domain hit(s) vs Pfam DUF4285 [PF14113], Evalue: 6.90E-27, Aligned region: 42..160
Protein Sequence: 163 a.a.     [Download]
>gi|296101904|ref|YP_003612050.1| putative cytoplasmic protein [Enterobacter cloacae subsp. cloacae ATCC 13047]
MSHMRPAFGAAWNRFKEVNVNVEQVGKLLGGKVQHNIDAGIFKNACPIRMSYVLNYCGIPVPSNSKYATV
TGSDKKRYMFRVKDMIAFLPTVLGKADISVSSPTPAQFAGKQGIIIFTGHGWLDATGHVTLWNGNICSDD
CHFLGSPGNGSFIPTNATFWSLK
-
Nucleotide Sequence: 492 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1563472-1563963 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGTCTCATATGCGTCCTGCTTTTGGTGCCGCCTGGAACCGATTTAAAGAAGTGAACGTCAACGTAGAAC
AGGTTGGCAAGTTATTGGGGGGGAAAGTTCAGCATAATATAGATGCTGGTATTTTTAAAAATGCCTGCCC
CATTCGTATGAGCTATGTTTTAAATTATTGTGGCATTCCAGTTCCTTCTAATAGTAAATATGCAACTGTG
ACCGGGAGCGACAAGAAGCGATATATGTTCCGTGTTAAAGATATGATTGCTTTTTTACCCACGGTATTGG
GAAAAGCTGACATATCTGTTTCTTCTCCAACCCCAGCACAATTTGCGGGCAAGCAAGGTATTATTATTTT
TACCGGGCATGGCTGGCTTGATGCAACCGGGCATGTAACACTCTGGAACGGAAATATTTGTTCGGATGAT
TGTCATTTCCTTGGCTCACCGGGTAATGGTTCATTTATCCCTACTAACGCAACCTTCTGGAGCCTGAAAT
GA

Reference
(1) Zhang H et al. (2013). Structure of the type VI effector-immunity complex (Tae4-Tai4) provides novel insights into the inhibition mechanism of the effector by its immunity protein. J Biol Chem. 288(8):5928-39. [PudMed:23288853] experimental in_silico
(2) Russell AB et al. (2012). A widespread bacterial type VI secretion effector superfamily identified using a heuristic approach. Cell Host Microbe. 11(5):538-49. [PudMed:22607806] experimental in_silico
 
experimental experimental literature
in_silico in silico analysis literature