SecReT6
Effector Protein ID: 296101929
-
SecReT6 ID395
T6SS typeA3
Gene symbol-
Locus tagECL_01567
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]1591543..1595931 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorECL_01567 (RhsA)
DescriptionrhsA
UniProt IDD5C6I1
KEGG IDenc:ECL_01567
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 6.80E-66, Aligned region: 394..406
RHS_repeat [PF05593], Evalue: 6.80E-66, Aligned region: 433..442
RHS_repeat [PF05593], Evalue: 6.80E-66, Aligned region: 483..511
RHS_repeat [PF05593], Evalue: 6.80E-66, Aligned region: 538..560
RHS_repeat [PF05593], Evalue: 6.80E-66, Aligned region: 591..627
RHS_repeat [PF05593], Evalue: 6.80E-66, Aligned region: 655..691
RHS_repeat [PF05593], Evalue: 6.80E-66, Aligned region: 697..733
RHS_repeat [PF05593], Evalue: 6.80E-66, Aligned region: 721..753
RHS_repeat [PF05593], Evalue: 6.80E-66, Aligned region: 760..796
RHS_repeat [PF05593], Evalue: 6.80E-66, Aligned region: 802..855
RHS_repeat [PF05593], Evalue: 6.80E-66, Aligned region: 869..898
RHS_repeat [PF05593], Evalue: 6.80E-66, Aligned region: 921..956
RHS_repeat [PF05593], Evalue: 6.80E-66, Aligned region: 984..1009
RHS_repeat [PF05593], Evalue: 6.80E-66, Aligned region: 1033..1064
RHS_repeat [PF05593], Evalue: 6.80E-66, Aligned region: 1056..1084
RHS_repeat [PF05593], Evalue: 6.80E-66, Aligned region: 1106..1135
RHS_repeat [PF05593], Evalue: 6.80E-66, Aligned region: 1144..1163
PAAR_motif [PF05488], Evalue: 6.30E-15, Aligned region: 5..15
PAAR_motif [PF05488], Evalue: 6.30E-15, Aligned region: 100..219
RHS [PF03527], Evalue: 2.00E-12, Aligned region: 737..753
RHS [PF03527], Evalue: 2.00E-12, Aligned region: 920..931
RHS [PF03527], Evalue: 2.00E-12, Aligned region: 933..946
RHS [PF03527], Evalue: 2.00E-12, Aligned region: 1116..1127
RHS [PF03527], Evalue: 2.00E-12, Aligned region: 1222..1261
DUF4150 [PF13665], Evalue: 1.30E-06, Aligned region: 105..124
DUF4150 [PF13665], Evalue: 1.30E-06, Aligned region: 165..215
DUF4150 [PF13665], Evalue: 1.30E-06, Aligned region: 1378..1421
Protein Sequence: 1462 a.a.     [Download]
>gi|296101929|ref|YP_003612075.1| hypothetical protein ECL_01567 [Enterobacter cloacae subsp. cloacae ATCC 13047]
MSDNNAARKGDEIIHSSIFADITSIVAEGAAYAVIGAAVGLAATAAAPLLGAGAAAAGVAAIGSSCLLSG
IVGGVLANLAGVTDDISNIAEGLGDALFPPSPAGKITTGSSNVLTNSLPAARAAGTLTPADTPPPEPQSP
GSFADYAGMLLSAAGQFGSEMWQPSVASAAAGTSPLEEDKVACEKHSGPQYLAEGSKSVFINGQPAVRAK
DRTTCEGTVSDDVSPNVIIGGETLTVRDIKSGKTPGLALGMIALSLLRGRPGKILKNMPCALAAAGGGML
ADMAVNAVFGSSHPVHAATGVKVLNDDDELDFSLPGRFPLRWQRSYNSLTTREGLFGLGWATTFDSYLTL
EENNATWFDETGRELSFELPPVDHAFYSISEGIIIRRNESGDVAIADDDGAVWRLYKPTRVNPSVLRLAS
LSDEYGNALLTEWDEHGRLVGLHDEPRAIDVSLLYEDERFPQRVTAASHFDGSRSWPLMQWGYDARGQLA
SATDASGVVTREYRYNDHGLMVWHRLPGGLESEYRWKKFDHWRVVENRTSTGDGCRFTYDLDAGLTTVEH
YDGQKRQHYWNAQNLIVRYVDERGENWCYTWDENELLTQRIDPLGNTVTFVYDEMGNRVQEIDPDGNART
TTWLEHRALPTAIIEADGSATRFWYDEHHGLNRVVDPMGQTTLLRRDEFGQVVEEVDAAGNSRHHEYNEA
GQVVRATDCSGHTTRYQYHPLGWLMTETGADGEETRYRYDAAGRPVQLDRPEGWTESLKWNKRGLPVKHA
GADGKESEFRYDEAGRLTATRNTQGEEVRRRWDSRGRLIALENENGEAYQFRWGPDSLLLEEVGLDGVAS
QYRYDACGRTIARTFAAGHPEAITHAFAWSASGQLVARTTPEGQTRYHYTPSGLLTRIGLHPALSADAWS
TEAEQELSFEYDALGRVTREAGEHGELAWQYDALGNRTSVTLPDGRELKQFYYGSGHLLSIALDKLSVSD
FTRDELHRETSRTQGLLTTRSEYDRLGRLHRRDVFTGNAQRPSPRRWSRRWDYDYRNNLVREERDDNPFS
WYRWQYDSAGRLLVQDGTLPGQEQWRWDAAGNPLDGSAEKITHNRLTQLNGIRWRYDIHGRTVEKDNGQT
RWHYRYDGEHRLTEVISQPRDRNRPQTQVSFRYDPLGRRISKTRQQMLGGQATGKPITTRFVWEGFRLLQ
ELHGDVPLTYVYSDQDSYDPLARIDGVDAPEIFWFHCQPNGTPERMTDIEGQVRWEGVNSAWGKLLRESE
TQLSGYSQNLRMQGQYLDRETGLHYNLFRYYDPDCGRFTQQDPIGLAGGINLYQYGANSLTRIDPLGLKQ
EEVIRYMSKDEAIASAAERGGKGGLVPNNRGDKAIWVNHDSRPGFNPGNEKYRAVMTVNDSGVELLNQHS
DISKVDYKETGLKDGVLSKRNEPGAKGIGKNILARFNDKITSFQIEKKDAKGNWKKCGKRIT
-
Nucleotide Sequence: 4389 bp     [Download]
>gi|296100371|ref|NC_014121.1|:1591543-1595931 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGAGCGATAACAACGCGGCCCGCAAGGGTGACGAGATTATTCACTCCAGCATTTTCGCGGATATCACCA
GCATTGTGGCGGAAGGTGCCGCCTACGCGGTGATCGGCGCGGCGGTAGGGCTGGCAGCAACTGCCGCCGC
ACCACTGCTGGGGGCCGGGGCAGCCGCTGCGGGCGTGGCGGCGATTGGATCCAGCTGCCTGTTAAGCGGG
ATCGTTGGCGGCGTACTGGCTAACCTGGCGGGTGTTACTGACGATATCAGTAATATCGCGGAGGGACTGG
GTGATGCGCTGTTCCCGCCGTCTCCCGCAGGTAAAATCACCACCGGCTCCAGCAACGTGCTCACCAATAG
CCTTCCCGCTGCACGCGCGGCCGGAACGCTGACCCCCGCAGATACGCCACCCCCAGAGCCACAGTCACCG
GGTAGTTTTGCCGATTACGCCGGCATGTTGCTCTCTGCTGCCGGACAGTTCGGCAGCGAAATGTGGCAGC
CGAGCGTGGCCTCCGCTGCGGCCGGTACATCGCCGCTGGAAGAGGATAAGGTCGCGTGTGAAAAACACTC
CGGACCACAGTATCTGGCGGAAGGCTCTAAAAGCGTCTTTATCAATGGACAACCGGCAGTACGTGCCAAA
GATCGCACCACCTGCGAAGGCACCGTTTCCGATGACGTTTCCCCGAATGTGATCATCGGCGGCGAGACGC
TGACGGTTCGCGATATCAAGAGCGGCAAAACGCCGGGGCTGGCACTGGGGATGATTGCGCTCTCCCTGCT
GCGCGGCCGTCCGGGCAAGATTTTAAAAAACATGCCCTGTGCCCTGGCAGCAGCCGGGGGCGGGATGCTG
GCCGATATGGCCGTCAATGCCGTATTTGGTTCCTCGCACCCGGTTCATGCCGCCACCGGCGTGAAGGTGC
TGAATGACGATGATGAGCTCGATTTCTCGCTGCCCGGGCGTTTTCCGCTTCGCTGGCAGCGCAGTTATAA
CAGCCTGACCACCCGCGAAGGGTTGTTTGGCCTGGGCTGGGCAACAACCTTTGACAGTTATCTGACGCTT
GAAGAGAACAATGCCACCTGGTTCGACGAAACCGGGCGTGAGCTGAGCTTTGAACTGCCACCCGTCGACC
ACGCATTCTACAGCATCAGCGAGGGTATCATCATCCGCCGCAACGAGAGCGGTGATGTGGCGATAGCCGA
TGATGACGGCGCGGTGTGGCGCCTGTATAAACCGACACGCGTGAATCCATCCGTTCTGCGTCTGGCCTCC
CTTAGCGACGAATACGGCAACGCACTGCTGACGGAGTGGGATGAGCACGGCAGGCTGGTCGGTTTGCACG
ATGAGCCGCGGGCAATAGACGTCTCCCTGCTCTATGAGGACGAACGGTTCCCACAGCGCGTAACCGCTGC
CAGCCATTTTGACGGCAGCCGTAGCTGGCCGCTGATGCAATGGGGTTACGATGCGCGTGGCCAGCTGGCG
AGCGCGACGGATGCCTCTGGTGTAGTCACCCGCGAATACCGCTATAACGACCATGGCCTGATGGTCTGGC
ATCGTCTGCCGGGCGGGCTGGAAAGTGAATACCGCTGGAAAAAATTTGACCACTGGCGCGTGGTTGAAAA
CCGCACCAGTACCGGGGATGGCTGTCGCTTCACCTACGATCTTGACGCCGGGTTGACCACCGTCGAACAC
TACGACGGTCAGAAACGTCAGCACTACTGGAACGCGCAAAATCTGATCGTCCGCTACGTTGACGAGCGCG
GCGAGAACTGGTGCTACACGTGGGATGAGAACGAGCTCCTCACGCAACGCATTGATCCGCTCGGGAACAC
CGTCACCTTCGTTTACGACGAGATGGGCAACCGGGTGCAGGAGATCGACCCTGACGGCAATGCCCGCACC
ACGACCTGGCTTGAACACCGCGCGCTACCGACGGCCATCATTGAAGCCGACGGCAGCGCTACCCGGTTCT
GGTACGACGAACATCACGGCCTGAACCGCGTGGTGGACCCAATGGGGCAGACCACGCTGCTGCGCCGGGA
TGAGTTTGGTCAGGTCGTTGAAGAGGTGGATGCCGCCGGAAACAGCCGCCATCATGAGTACAACGAAGCA
GGACAAGTGGTGCGTGCGACAGACTGCTCTGGCCACACCACCCGCTACCAATATCATCCGCTGGGCTGGT
TGATGACCGAGACGGGCGCCGACGGCGAAGAGACGCGTTATCGCTACGACGCTGCCGGGCGCCCGGTACA
GCTCGATCGCCCGGAAGGCTGGACAGAGTCGCTAAAATGGAACAAACGTGGCCTGCCGGTGAAGCATGCT
GGCGCCGACGGGAAAGAAAGCGAGTTCAGATACGATGAGGCCGGACGCTTAACCGCCACGCGTAATACCC
AGGGTGAAGAGGTCCGCCGCCGCTGGGACAGCAGAGGGCGTCTGATTGCCCTTGAAAATGAAAACGGCGA
AGCGTATCAGTTCCGCTGGGGGCCTGACTCGCTCTTGCTGGAGGAGGTGGGGCTCGATGGTGTGGCCTCG
CAGTATCGCTACGACGCCTGTGGGCGCACGATAGCGCGTACCTTTGCTGCCGGTCATCCGGAGGCCATCA
CCCACGCCTTTGCCTGGAGCGCGAGCGGGCAACTGGTCGCCCGCACTACGCCGGAAGGGCAGACCCGCTA
CCACTACACCCCGTCAGGGCTGCTGACCCGGATTGGGCTGCACCCGGCGCTTTCAGCCGACGCGTGGAGT
ACCGAGGCTGAGCAGGAGCTTTCCTTTGAGTATGACGCACTTGGTCGCGTGACCCGCGAAGCGGGCGAGC
ACGGTGAGCTGGCATGGCAGTATGATGCCCTTGGCAACCGCACCTCCGTTACGCTGCCGGATGGCCGCGA
ACTCAAACAGTTCTACTACGGCAGCGGGCATCTGCTCAGCATTGCCCTTGATAAGTTGTCGGTATCCGAC
TTTACCCGCGACGAACTCCACCGGGAGACCAGCCGCACGCAGGGGCTGCTCACCACCCGCAGCGAATACG
ACCGTTTAGGCCGCCTGCATCGCCGGGACGTCTTCACCGGCAACGCCCAGCGCCCGTCACCTCGCCGCTG
GTCCCGCCGCTGGGATTATGACTACCGCAATAACCTGGTGCGGGAAGAACGGGATGATAATCCGTTCAGC
TGGTACCGCTGGCAGTACGACAGCGCCGGGCGCCTGCTCGTTCAGGACGGCACGCTGCCCGGGCAGGAGC
AGTGGCGCTGGGATGCGGCCGGTAACCCGCTCGACGGATCTGCTGAAAAGATCACGCACAACCGTCTGAC
GCAGCTGAACGGCATTCGCTGGCGTTATGACATCCACGGCCGCACCGTGGAGAAGGATAACGGCCAGACC
CGCTGGCACTATCGGTACGACGGTGAACACCGCCTGACAGAAGTGATCAGCCAGCCGCGGGATCGTAACA
GGCCGCAGACGCAGGTCAGCTTCCGTTACGATCCGCTTGGACGCCGCATCAGCAAAACGCGCCAGCAGAT
GCTGGGCGGACAGGCAACCGGTAAGCCCATCACCACCCGGTTTGTCTGGGAAGGGTTCCGCCTGCTGCAG
GAGCTGCACGGAGACGTGCCGCTGACCTATGTCTACAGCGATCAGGACAGCTACGACCCGCTGGCACGTA
TTGACGGCGTTGATGCTCCGGAGATTTTCTGGTTCCACTGCCAGCCGAACGGCACGCCGGAACGGATGAC
GGATATCGAAGGGCAGGTGCGCTGGGAAGGCGTTAACAGCGCCTGGGGCAAGCTGCTACGGGAAAGCGAG
ACGCAGCTATCAGGATATTCCCAGAACCTGCGGATGCAGGGGCAATACCTGGACCGTGAGACAGGGCTGC
ACTACAATCTGTTCCGGTATTACGACCCGGACTGCGGGCGGTTTACGCAGCAGGACCCGATAGGGCTGGC
GGGAGGGATAAATCTTTACCAGTATGGTGCTAATAGTCTAACCCGAATAGACCCTCTGGGATTAAAACAA
GAGGAAGTTATACGCTATATGAGTAAAGATGAAGCGATTGCATCAGCTGCTGAACGCGGTGGTAAAGGCG
GATTGGTTCCTAATAATCGTGGCGATAAAGCCATATGGGTTAATCATGATAGTCGACCAGGATTTAACCC
TGGTAATGAAAAGTATCGTGCAGTTATGACTGTAAATGATTCTGGGGTTGAGCTTCTTAATCAACACAGT
GATATATCAAAGGTTGATTATAAAGAGACCGGCCTGAAGGATGGCGTTCTTTCAAAAAGAAATGAACCAG
GAGCAAAGGGTATCGGTAAAAATATCCTGGCTCGTTTTAATGATAAAATTACCTCATTCCAGATTGAAAA
GAAAGATGCTAAAGGTAATTGGAAGAAATGTGGCAAGAGGATTACTTAA

Reference
(1) Whitney JC et al. (2014). Genetically distinct pathways guide effector export through the type VI secretion system. Mol Microbiol. 92(3):529-42. [PudMed:24589350] experimental
 
experimental experimental literature