SecReT6
Effector Protein ID: 296102506
-
SecReT6 ID396
T6SS typeA2
Gene symbol-
Locus tagECL_02155
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]2199781..2200263 [+]
ProductHcp family type VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDD5C9Q5
KEGG IDenc:ECL_02155
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 4.60E-37, Aligned region: 8..146
Protein Sequence: 160 a.a.     [Download]
>gi|296102506|ref|YP_003612652.1| Hcp family type VI secretion system effector [Enterobacter cloacae subsp. cloacae ATCC 13047]
MAIPVYLFLTDDGGAKITGSVDVHDREGSIEVTGFTHNLRLPTDALTGKITGKRNHAPIVFQKEIDSSSP
YLMKAVATGQTLKTAEFKWYRINDAGQEVEYYNMHLDNIRVVSVTPLMHDTKDQTKEKHNHLEVVELRYD
KITWTYCDGNLRFADSWAER
-
Nucleotide Sequence: 483 bp     [Download]
>gi|296100371|ref|NC_014121.1|:2199781-2200263 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGGCAATTCCTGTATATCTTTTCTTAACTGACGACGGCGGTGCAAAAATCACCGGCTCGGTAGATGTTC
ATGATCGTGAAGGGAGCATAGAAGTTACTGGCTTTACGCATAACCTCCGGCTGCCAACAGATGCTTTAAC
GGGAAAAATCACTGGTAAACGTAACCATGCCCCCATCGTTTTTCAAAAGGAGATTGATTCCTCTTCCCCT
TATCTGATGAAAGCTGTTGCGACTGGGCAAACACTAAAAACGGCGGAATTCAAATGGTATCGCATAAACG
ATGCCGGACAGGAAGTGGAATATTACAATATGCATCTCGATAATATTCGCGTCGTTTCCGTTACGCCCTT
AATGCATGACACGAAGGATCAAACGAAAGAAAAACACAATCATCTTGAAGTTGTGGAGCTGCGCTACGAC
AAGATTACCTGGACGTATTGCGACGGTAATTTGCGTTTCGCAGATAGCTGGGCAGAGCGTTAA