SecReT6
Effector Protein ID: 296104321
SecReT6 ID396
T6SS typeA2
Gene symbol-
Locus tagECL_03984
StrainEnterobacter cloacae subsp. cloacae ATCC 13047
Repliconchromosome [GenBank: NC_014121] [Browse all T6SS(s) in this replicon]
Location [Strand]4091478..4091966 [-]
ProductHcp family type VI secretion system effector
Effector typeProtein
Homologous effectorHcp
DescriptionHcp protein
UniProt IDD5C8C8
KEGG IDenc:ECL_03984
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.80E-33, Aligned region: 8..145
Protein Sequence: 162 a.a.     [Download]
>gi|296104321|ref|YP_003614467.1| Hcp family type VI secretion system effector [Enterobacter cloacae subsp. cloacae ATCC 13047]
MMAVPVHLWLKDDAGNLIKGSSDVEHREGSIELRGLTHNLSIPVDGTTGSLTGTRQHAPFLFEKEIDSAS
PYLYRAVATGQALKSAEVKWYHINDAGQEVEYFNILLESVKVVSITPIMHDTRNCPGTGHMESIQLRYEK
ITWRYVDGNIQYSDAWNERATV
-
Nucleotide Sequence: 489 bp     [Download]
>gi|296100371|ref|NC_014121.1|:c4091966-4091478 Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete genome
ATGATGGCTGTACCGGTCCATTTATGGCTAAAAGATGATGCAGGGAATCTGATTAAGGGGTCATCTGACG
TAGAACATAGAGAAGGGAGTATTGAATTACGTGGTTTGACACATAATTTAAGTATCCCGGTTGATGGGAC
AACAGGAAGCCTCACCGGAACACGTCAGCACGCTCCTTTCCTGTTTGAAAAAGAAATTGACAGCGCATCC
CCCTATCTTTATCGGGCTGTTGCAACAGGGCAAGCTCTCAAATCTGCAGAGGTAAAGTGGTACCACATTA
ATGATGCAGGGCAGGAAGTCGAATACTTCAATATTTTACTGGAAAGTGTAAAAGTTGTTTCTATTACGCC
AATTATGCACGATACACGTAACTGTCCGGGAACAGGGCACATGGAAAGCATTCAACTGCGCTACGAGAAA
ATCACATGGCGTTATGTTGATGGAAATATTCAATACTCCGATGCCTGGAATGAGCGAGCTACGGTTTGA