SecReT6
Effector Protein ID: 299770685
-
SecReT6 ID400
T6SS typeA4b
Gene symbol-
Locus tagAOLE_12255
StrainAcinetobacter oleivorans DR1
Repliconchromosome [GenBank: NC_014259] [Browse all T6SS(s) in this replicon]
Location [Strand]2634726..2635229 [-]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorA1S_1296
DescriptionHcp protein
UniProt IDD8JML3
KEGG IDacd:AOLE_12255
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.60E-42, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|299770685|ref|YP_003732711.1| type VI secretion system effector [Acinetobacter oleivorans DR1]
MKDIYVEFRGKYKVDGESRDSEHKGWLEVNSWSHNIRQPKSATSSSVGGHTAERVEHSDMLFIKDLDATS
PKLWEACSAGYTFDEVQIDFYRANGDKRIKYLQIKLKHVLVSSVTPTVNEEGVPTEAFGLKYAAVEWTYN
QQDINGTAKGAVTKKWSLSNNTASYAA
-
Nucleotide Sequence: 504 bp     [Download]
>gi|299768250|ref|NC_014259.1|:c2635229-2634726 Acinetobacter oleivorans DR1 chromosome, complete genome
ATGAAAGATATATACGTTGAGTTTCGCGGTAAATATAAAGTTGATGGCGAGTCTCGTGACTCTGAGCACA
AAGGCTGGTTAGAAGTTAACTCTTGGTCTCATAACATTCGTCAACCTAAATCTGCTACTTCAAGTAGTGT
TGGTGGCCATACTGCTGAACGTGTTGAACATTCAGATATGCTTTTTATTAAAGACCTAGATGCAACTAGC
CCGAAATTATGGGAAGCATGTTCAGCTGGTTATACATTTGATGAAGTACAAATTGATTTTTATCGTGCAA
ATGGCGATAAACGTATCAAGTACTTACAAATTAAATTGAAGCATGTTCTAGTTTCTAGCGTAACTCCAAC
AGTTAACGAAGAAGGTGTTCCAACTGAAGCGTTTGGTTTGAAATACGCAGCTGTTGAGTGGACTTATAAC
CAACAAGATATTAACGGTACTGCTAAAGGTGCTGTTACTAAGAAATGGTCACTTTCTAATAATACTGCTT
CTTACGCAGCATAA