SecReT6
Effector Protein ID: 300693668
sciK
SecReT6 ID404
T6SS typeA4b
Gene symbolsciK
Locus tagRPSI07_mp0658
StrainRalstonia solanacearum PSI07
Repliconmegaplasmid [GenBank: NC_014310] [Browse all T6SS(s) in this replicon]
Location [Strand]807927..808430 [+]
Productsecretion system protein (evpc-like), hemolysin-coregulated protein
Effector typeProtein
Homologous effectorBCAL0343
DescriptionHcp protein
UniProt IDD8N062
KEGG IDrsl:RPSI07_mp0658
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.60E-43, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|300693668|ref|YP_003749641.1| secretion system protein (evpc-like), hemolysin-coregulated protein [Ralstonia solanacearum PSI07]
MKDIYVKFDSPAIKGESQDKDHKDWIEVNSWSQSIVQPRSATASTAGGHTAERCEHRDMVFAKDLDVVSP
LLYQHVSGGTTFGEVTIEFFRADGEGNRVKYLEVKLKNAILSEVDSQVVAQGIPTDTFSLRYASVQWKYT
QQKSAGGQGGNSQGAWSLTKNDKTYSV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|300693042|ref|NC_014310.1|:807927-808430 Ralstonia solanacearum PSI07 megaplasmid, complete sequence
ATGAAGGATATCTACGTCAAGTTTGACAGCCCGGCCATCAAGGGGGAGTCGCAGGACAAGGATCACAAGG
ACTGGATCGAAGTCAACAGCTGGTCCCAGTCGATCGTCCAGCCGCGTTCGGCCACGGCCTCGACCGCGGG
CGGCCATACCGCCGAGCGTTGCGAGCACCGCGACATGGTGTTCGCCAAGGATCTGGACGTGGTCAGCCCG
CTGCTGTACCAGCACGTTTCGGGTGGCACGACCTTCGGTGAAGTGACGATCGAGTTCTTCCGCGCCGACG
GCGAAGGCAACCGCGTGAAGTACCTCGAAGTCAAGCTGAAGAACGCCATCCTGAGCGAAGTGGATTCGCA
AGTGGTGGCCCAGGGCATTCCGACCGACACCTTCAGCCTGCGCTACGCCTCGGTGCAGTGGAAGTACACC
CAGCAGAAGAGTGCCGGCGGCCAGGGCGGCAACTCGCAGGGCGCCTGGAGCCTGACCAAGAACGACAAGA
CCTACTCGGTTTAA