SecReT6
Effector Protein ID: 300697351
sciK
SecReT6 ID782
T6SS typeA4b
Gene symbolsciK
Locus tagRCFBP_mp20188
StrainRalstonia solanacearum CFBP2957
Repliconplasmid RCFBPv3_mp [GenBank: NC_014309] [Browse all T6SS(s) in this replicon]
Location [Strand]893989..894492 [+]
Productsecretion system protein (EvpC-like), Hemolysin-coregulated protein
Effector typeProtein
Homologous effectorRSp0745
DescriptionHcp protein
UniProt IDD8P3X9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.50E-44, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|300697351|ref|YP_003748012.1| secretion system protein (EvpC-like), Hemolysin-coregulated protein [Ralstonia solanacearum CFBP2957]
MKDIYVKFDSPAIKGESQDKDHKDWIEVNSWSQSIVQPRSATASTAGGHTAERCEHRDMVFTKDLDVVSP
LLYQHASGGTTFGEVTIEFFRADGEGNRVKYLEVKLKNAILSEVDSQVVAQGIPTDTFSLRYASVQWKYT
QQKSAGGQGGNSQGAWSLTKNDKTYSV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|300696564|ref|NC_014309.1|:893989-894492 Ralstonia solanacearum CFBP2957 plasmid RCFBPv3_mp, complete genome
ATGAAGGATATCTACGTCAAGTTCGACAGCCCGGCCATCAAGGGGGAATCGCAGGACAAGGATCACAAGG
ACTGGATCGAAGTCAACAGCTGGTCCCAGTCGATTGTCCAGCCGCGTTCGGCCACCGCCTCGACCGCGGG
CGGCCACACCGCCGAGCGTTGCGAGCACCGCGACATGGTGTTCACCAAGGACCTGGACGTGGTCAGCCCG
CTGCTGTACCAGCACGCTTCGGGTGGTACGACCTTCGGTGAAGTGACGATCGAGTTCTTCCGCGCCGACG
GCGAAGGCAACCGCGTGAAGTACCTCGAAGTCAAGCTGAAGAACGCCATCCTGAGCGAAGTGGATTCGCA
GGTCGTGGCCCAGGGCATCCCGACCGACACCTTCAGCCTGCGCTACGCTTCGGTGCAGTGGAAGTACACG
CAGCAGAAGAGCGCCGGCGGCCAGGGCGGCAACTCGCAGGGCGCCTGGAGCCTCACCAAGAACGACAAGA
CCTACTCGGTTTAA