SecReT6
Effector Protein ID: 300714998
-
SecReT6 ID401
T6SS typeA2
Gene symbol-
Locus tagEbC_04100
StrainErwinia billingiae Eb661
Repliconchromosome [GenBank: NC_014306] [Browse all T6SS(s) in this replicon]
Location [Strand]487379..487870 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDD8MM57
KEGG IDebi:EbC_04100
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 1.80E-36, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|300714998|ref|YP_003739801.1| unnamed protein product [Erwinia billingiae Eb661]
MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQEHNLYIPTDNNTGKLTGTRVHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTRLENVKLVKVAPLMHDIKDASKEKHNHLERIELRYE
KITWTYKDGNIIHSDSWNERTTA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|300714588|ref|NC_014306.1|:487379-487870 Erwinia billingiae Eb661 chromosome, complete genome
ATGGCAATTCCAGTCTATCTGTGGCTGAAAGACGACGGCGGTGCGGACATCAAAGGCTCCGTGGACGTGA
AAGACCGTGAAGGCAGCATCGAAGTGGTGGCGCAGGAACACAACCTGTACATCCCGACCGACAACAACAC
CGGCAAGCTGACCGGGACCCGCGTGCACACGCCGTTCCTGTTCACCAAGGAAATCGACTCATCCAGCCCG
TACCTCTACAAGGCGGTCACCACCGGTCAGACCCTGAAATCCGCCGAGTTCAAGTGGTACCGCATCAACG
ATGCCGGTCAGGAAGTGGAGTATTTCAACACCCGGCTTGAGAACGTCAAGCTGGTGAAAGTCGCGCCGCT
GATGCACGACATCAAGGATGCGTCGAAAGAGAAGCACAACCACCTGGAGCGCATTGAACTGCGCTACGAA
AAAATCACCTGGACCTACAAAGACGGCAACATCATTCATTCCGATTCATGGAACGAACGCACCACCGCTT
AA