SecReT6
Effector Protein ID: 307129607
-
SecReT6 ID409
T6SS typeA1
Gene symbol-
Locus tagDda3937_01758
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]907392..911696 [-]
ProductRhs-family protein
Effector typeProtein
Homologous effectorDda3937_01758
DescriptionRhsA
UniProt IDE0SAK8
KEGG IDddd:Dda3937_01758
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 410..424
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 466..493
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 486..513
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 557..585
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 592..627
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 633..669
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 676..711
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 730..756
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 766..799
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 806..842
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 847..876
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 867..896
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 903..922
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 940..975
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 979..991
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 986..1024
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 1011..1041
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 1065..1094
RHS_repeat [PF05593], Evalue: 2.00E-56, Aligned region: 1112..1140
PAAR_motif [PF05488], Evalue: 2.00E-17, Aligned region: 9..22
PAAR_motif [PF05488], Evalue: 2.00E-17, Aligned region: 113..178
Endonuclea_NS_2 [PF13930], Evalue: 4.90E-11, Aligned region: 462..480
Endonuclea_NS_2 [PF13930], Evalue: 4.90E-11, Aligned region: 864..882
Endonuclea_NS_2 [PF13930], Evalue: 4.90E-11, Aligned region: 994..1005
Endonuclea_NS_2 [PF13930], Evalue: 4.90E-11, Aligned region: 1025..1040
Endonuclea_NS_2 [PF13930], Evalue: 4.90E-11, Aligned region: 1326..1416
RHS [PF03527], Evalue: 1.60E-05, Aligned region: 568..581
RHS [PF03527], Evalue: 1.60E-05, Aligned region: 634..646
RHS [PF03527], Evalue: 1.60E-05, Aligned region: 1205..1223
Protein Sequence: 1434 a.a.     [Download]
>gi|307129607|ref|YP_003881623.1| unnamed protein product [Dickeya dadantii 3937]
MLNDILSRVARVGAMHAGNRPNPPDDRPQPCRGKPPTSPGKTIKHKSFLGALAGAVAGALVAAAVAAAAV
FLVGVTGGLAVAAVGALAVFAAGDLISAVTNKVSAMVDSASPAFGPVASGSGNVFVEKQPVARATKDTVA
CTKHNSPQLIAQGSESVFVNDAPAARIDDKTVCGATVKEGASTVFFGSGQGTYLDIADEFSWWEKALLIA
VEFLVPPSRGMLKGLGKLFIRGPKAVLRGSRAGAKWIAGRLADKSSCASKAFKASSGLTRAKAAVKAFLK
DPVYIASGEVIESRTDIELGQTLPLAFERTYRSASVHIGLLGRGWHDSWSEVATVTRDGLNTHVVITLAQ
GYDIDFTFHQDVQAVYCPHYPEFTLHRRGDGFSLWHRDQQTWRDFSVVQGERRLLSAIHDSHDNRIELVR
DPKGYLRQVRHSDGVTLLLVWQGEFLHQIQRIDGGQKTLLAEYRQDEQGRLVEANATQAYHLYYDYDAAH
RLTRWHDNDQTWARYEYDAQGRCVYTTCADGFLTARFDYLPDRVVMTDGLGQCSEFGFNDLFLMSWEKSP
LGHVTRYEYDDYGNLLREISPAGRVVEFTYLDDTGRVSTFTDASGHQWQYDYDAAQRLCGVTDPLGREWG
WMYDAEGNPERLTGPDASEVRFTWNRYGLLTQVSDAAGEVQARLQYDHRQRLLSATDAESRTRQLRYDGQ
DRVVQWQRADGARFRLGYRRASWTLPEQLIRPDDKEEQRQYDRHNNLLSYVDGNGALWRQTFGPFDLLTA
RTDAEGRTWHYAYDKESQQLTTVIAPDGSHWQWWLDADGRVIRERDMTGTETHYDYDEDGLCIRVRNGEG
DTRHFLYDARGLLLRETAPDDTLHYRYDAVGRLTEVSSSTAHVQLEYDLRDRMVREWHNGTLLTRQVDDA
ARTVTRTLTWDGDADDTINALAPLTSLFHYTRTGELRQVQLPDGADLTLTHDAAGRESHRTGGSGFVQQR
EYDVMGWLTREMSGAQHDGHLLATQTREYRYDGAGNLTGVRHNRDAEGYRLDATGRVQEILSGGAGKPVD
TTARFLYTRTGLPQEAGRLTEWQAGRLVQHDDTHYQYDRAGRLIRKQVVQPGYRPQVWQYRWDSRNQLRV
VDTPNGERWLYRYDPFGRRVGKRCDQKAEEIRYLWDGDQIAEIRHYRHGQLIQRRHWVYNGWELVVQQRQ
HTGGDWETDFVTSSQNGTPQALFTPDGTLRWQAPKATLWGQRQAEKSESPDPGLAFAGQLRDSESGLCYN
RFRYYDPAGGCYVSPDPIGIAGGESNYGYVSNPMCWVDPFGLAKCPTLAHGANGEILSAKATVSKAELRT
GSGTNQSSRDYARSLGNQTDDAGHILGNVLGGQGGKGNVFPQLPAINRGQYRDFEKVVKDYIGQHGSVDI
EWAFKYGNGGTRPTEIYYDVYQNGQKVFGRIFNN
-
Nucleotide Sequence: 4305 bp     [Download]
>gi|307128764|ref|NC_014500.1|:c911696-907392 Dickeya dadantii 3937 chromosome, complete genome
ATGCTCAACGATATTCTGAGCCGGGTGGCCCGGGTCGGGGCCATGCACGCCGGTAATCGTCCCAACCCGC
CCGACGACCGTCCGCAGCCCTGCAGGGGCAAGCCACCGACCTCGCCGGGCAAGACCATCAAGCACAAGAG
TTTTCTCGGCGCGCTGGCCGGGGCCGTAGCCGGGGCGCTGGTCGCCGCGGCCGTCGCGGCAGCGGCAGTG
TTTCTGGTCGGTGTCACCGGCGGGCTGGCGGTGGCGGCCGTCGGGGCACTGGCGGTGTTTGCTGCCGGTG
ACCTGATTTCCGCCGTCACCAACAAGGTCTCGGCGATGGTGGACAGTGCGTCGCCGGCCTTCGGGCCGGT
GGCGTCCGGCTCCGGTAACGTGTTTGTCGAAAAACAGCCCGTCGCCCGCGCCACGAAAGACACCGTCGCC
TGCACCAAGCACAACAGCCCGCAACTGATTGCCCAGGGCAGCGAGTCGGTGTTTGTGAACGACGCGCCGG
CGGCCCGTATCGACGACAAAACCGTGTGTGGCGCCACTGTCAAGGAAGGGGCCTCGACGGTATTCTTTGG
CTCCGGTCAGGGCACCTATCTGGACATCGCCGACGAATTCAGCTGGTGGGAAAAGGCGCTGCTGATTGCG
GTGGAGTTTCTGGTGCCGCCCAGCCGGGGGATGTTGAAGGGACTGGGAAAGCTGTTTATCCGTGGTCCCA
AGGCAGTACTACGCGGATCCAGAGCCGGGGCAAAGTGGATTGCCGGTCGCCTCGCGGATAAATCATCTTG
TGCCAGCAAGGCTTTCAAAGCCAGTAGTGGGCTGACGCGAGCCAAGGCAGCAGTAAAAGCGTTCCTGAAA
GACCCGGTCTATATCGCCAGCGGCGAGGTGATTGAATCCCGTACCGATATCGAACTGGGCCAGACGCTGC
CGCTGGCGTTCGAGCGGACCTACCGCTCCGCCTCCGTGCATATCGGGCTACTGGGCCGCGGCTGGCACGA
CAGCTGGAGCGAAGTGGCGACGGTGACGCGCGACGGCCTCAACACCCACGTGGTCATCACGCTGGCGCAG
GGCTACGACATCGATTTTACCTTCCATCAGGACGTGCAGGCGGTGTACTGCCCGCACTACCCTGAATTCA
CCCTGCACCGTCGGGGCGACGGCTTCAGCCTGTGGCACCGCGACCAGCAGACCTGGCGCGACTTTAGCGT
GGTACAGGGTGAGCGACGGTTGCTGTCGGCCATTCACGATAGCCACGACAACCGCATTGAGCTGGTGCGC
GACCCCAAAGGCTACCTGCGCCAGGTGCGCCACAGCGACGGCGTCACCCTGCTGCTGGTGTGGCAGGGCG
AATTCCTGCACCAGATACAACGCATCGATGGCGGCCAGAAGACGTTGCTGGCCGAGTACCGCCAGGACGA
GCAGGGGCGGCTGGTGGAGGCCAACGCCACCCAGGCCTACCACCTCTACTACGACTACGATGCGGCCCAC
CGGCTGACCCGCTGGCACGACAACGACCAGACCTGGGCGCGCTACGAATACGACGCGCAGGGGCGCTGCG
TCTACACCACCTGCGCCGACGGTTTTCTGACCGCCCGCTTCGACTACCTCCCCGACAGGGTGGTGATGAC
CGATGGCCTCGGCCAGTGCAGCGAATTCGGCTTCAACGACCTGTTCCTGATGAGCTGGGAAAAATCCCCG
CTCGGCCACGTCACCCGCTACGAGTACGACGATTACGGCAACCTGCTGCGGGAAATCTCGCCCGCCGGGC
GGGTGGTCGAATTCACCTATCTGGACGATACCGGGCGGGTCAGCACCTTTACCGACGCCAGCGGCCATCA
GTGGCAGTACGACTACGACGCCGCGCAGCGGTTGTGCGGCGTGACCGACCCGCTGGGCCGCGAGTGGGGC
TGGATGTATGACGCCGAGGGTAACCCGGAACGCCTGACCGGCCCGGACGCCAGCGAGGTACGATTCACCT
GGAACCGCTACGGCCTGCTGACCCAGGTCAGCGACGCCGCCGGTGAGGTGCAGGCCCGGTTACAGTACGA
CCACCGTCAGCGGCTGCTGAGCGCCACTGACGCCGAGAGCCGTACCCGGCAGTTACGCTACGACGGGCAG
GACCGGGTAGTGCAGTGGCAACGGGCGGACGGTGCCCGTTTCCGGCTCGGCTACCGCCGGGCCAGTTGGA
CACTGCCGGAGCAGCTGATCCGCCCGGATGACAAGGAAGAGCAGCGCCAGTACGACCGCCACAACAACCT
GCTGAGCTACGTGGACGGCAACGGCGCGCTGTGGCGTCAGACCTTCGGCCCGTTCGACCTGCTGACCGCG
CGCACCGACGCCGAAGGCCGCACCTGGCACTACGCGTACGATAAAGAGAGCCAGCAACTGACAACGGTTA
TTGCCCCCGATGGCAGCCACTGGCAATGGTGGCTGGATGCCGACGGGCGGGTCATCCGCGAACGCGACAT
GACCGGCACCGAGACCCACTACGATTACGACGAGGACGGCCTGTGCATCCGCGTGCGTAACGGCGAAGGC
GATACCCGTCACTTTCTGTACGACGCCCGCGGGCTGCTGCTGCGTGAAACCGCGCCGGACGACACCCTGC
ACTACCGGTACGATGCGGTGGGCCGCCTGACCGAGGTCTCTTCGTCCACCGCCCATGTGCAGCTGGAGTA
CGACCTGCGCGACCGGATGGTGCGCGAATGGCACAACGGCACGCTGCTCACCCGCCAGGTTGATGACGCG
GCCCGCACCGTCACCCGTACGCTGACCTGGGACGGCGATGCGGACGACACGATAAACGCCCTCGCGCCGC
TCACCAGCCTGTTCCATTACACCCGCACCGGCGAGCTGCGGCAGGTGCAACTGCCGGACGGTGCCGACCT
GACCCTGACACATGACGCGGCAGGCCGCGAGTCACACCGTACCGGCGGCAGCGGTTTTGTGCAGCAGCGG
GAATACGATGTAATGGGCTGGCTGACGCGGGAGATGAGCGGCGCACAGCACGACGGCCACCTGCTGGCGA
CACAGACGCGGGAATACCGCTACGACGGTGCCGGCAACCTGACCGGGGTACGTCACAACCGCGACGCCGA
AGGTTATCGTCTGGACGCCACCGGCCGGGTGCAGGAAATCCTGAGCGGCGGGGCGGGCAAACCGGTGGAC
ACCACCGCCCGCTTCCTCTACACCCGCACCGGTCTGCCGCAGGAGGCGGGACGCCTCACCGAGTGGCAGG
CCGGCAGACTGGTTCAGCACGATGACACCCATTACCAGTACGACAGGGCCGGACGGCTTATCCGTAAACA
GGTGGTACAGCCGGGTTACCGCCCCCAGGTATGGCAGTACCGCTGGGACAGCCGCAACCAGCTGCGGGTG
GTGGATACCCCGAACGGCGAACGCTGGCTGTACCGTTACGACCCGTTTGGCCGCCGGGTGGGCAAACGCT
GCGACCAGAAAGCCGAAGAAATTCGCTACCTGTGGGACGGCGACCAGATAGCGGAAATCCGCCACTACCG
CCACGGCCAGCTGATACAACGCCGCCACTGGGTCTACAACGGCTGGGAGCTGGTGGTGCAGCAGCGCCAG
CACACCGGCGGCGACTGGGAAACGGATTTTGTCACCAGCAGCCAGAACGGCACCCCGCAGGCGCTGTTCA
CGCCGGACGGCACCCTGCGCTGGCAGGCACCGAAAGCCACACTGTGGGGCCAGCGGCAGGCAGAAAAATC
GGAAAGTCCGGACCCCGGTCTGGCCTTCGCCGGGCAGCTCCGTGACAGCGAAAGCGGGCTGTGCTATAAC
CGCTTTCGGTACTACGACCCGGCCGGTGGGTGTTATGTGTCGCCAGACCCGATAGGGATAGCGGGGGGAG
AGAGTAACTACGGGTATGTCTCAAATCCCATGTGCTGGGTCGACCCATTTGGGTTGGCGAAGTGCCCGAC
GTTAGCTCATGGCGCTAACGGGGAAATATTATCAGCCAAAGCCACCGTATCGAAAGCCGAGCTTAGAACG
GGTTCCGGAACGAATCAAAGCTCCAGAGATTACGCCCGTTCATTAGGTAATCAAACCGATGATGCCGGAC
ACATATTAGGCAATGTGCTTGGTGGTCAAGGCGGTAAAGGGAATGTGTTCCCGCAGTTGCCTGCTATTAA
CCGCGGACAATATAGAGACTTTGAAAAGGTTGTGAAAGATTATATCGGGCAGCATGGTTCGGTTGATATT
GAATGGGCCTTTAAATATGGCAATGGTGGAACCCGACCTACAGAAATCTACTATGACGTCTATCAAAATG
GACAGAAAGTCTTTGGTAGAATATTCAATAACTAA

Reference
(1) Koskiniemi S et al. (2013). Rhs proteins from diverse bacteria mediate intercellular competition. Proc Natl Acad Sci U S A. 110(17):7032-7. [PudMed:23572593] experimental
 
experimental experimental literature