SecReT6
Effector Protein ID: 307130200
hcpB
SecReT6 ID409
T6SS typeA1
Gene symbolhcpB
Locus tagDda3937_00833
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]1554817..1555335 [+]
Producthypothetical protein
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDE0SGL0
KEGG IDddd:Dda3937_00833
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.50E-37, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|307130200|ref|YP_003882216.1| hcpB gene product [Dickeya dadantii 3937]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVQGHEDEMLVQEFKHIVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALASGEMLPTVTLKWYRTSVEGKQEHFFTTTLTDATIVDINNQMPHCQDPSKQDYTQ
LIEVSLAYRKVDWEHTVAGTSGSDDWRAPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|307128764|ref|NC_014500.1|:1554817-1555335 Dickeya dadantii 3937 chromosome, complete genome
ATGCCAACTCCATGCTATATCAGCATCGAAGGTAAAACTCAGGGCAATATCACCGCCGGTGCCTTTACTT
CCGACTCCGTCGGCAATATCTACGTGCAAGGCCACGAAGATGAGATGCTGGTTCAGGAATTCAAACACAT
CGTCACCGTACCGACCGATCCTCAGTCCGGCCAGCCGTCCGGTCAGCGCGTGCACAAACCGTTCAAATTC
ACCGTGGCGCTGAACAAGGCCGTGCCGCTGCTGTATAACGCGCTGGCGTCCGGCGAAATGCTGCCGACCG
TGACCCTGAAGTGGTATCGCACCTCTGTCGAAGGCAAGCAGGAGCATTTCTTCACCACCACCCTGACCGA
TGCCACCATCGTCGACATTAACAACCAGATGCCGCACTGCCAGGATCCGTCCAAGCAGGATTACACCCAG
CTGATCGAAGTGTCGCTGGCTTACCGCAAGGTTGACTGGGAACACACCGTGGCCGGCACCTCCGGCTCCG
ACGACTGGCGCGCGCCGATCGAAGCGTAA