SecReT6
Effector Protein ID: 307130201
-
SecReT6 ID409
T6SS typeA1
Gene symbol-
Locus tagDda3937_00832
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]1555504..1557540 [+]
ProductVgrG protein
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDE0SGL1
KEGG IDddd:Dda3937_00832
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.60E-67, Aligned region: 30..328
Phage_base_V [PF04717], Evalue: 2.60E-22, Aligned region: 367..459
Protein Sequence: 678 a.a.     [Download]
>gi|307130201|ref|YP_003882217.1| unnamed protein product [Dickeya dadantii 3937]
MANSTGLQFTVKIGALADTTFAVVDFELSEALNQPFALSLSLASSQVDIDFGAVLDQPCELMVWYEGALQ
RRVSGIVSRFAQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQTKKPDEIITQLLQEAGISDFAFSLRHE
HAVREYCVQYRESDLTFINRLAAEEGMFYFHEFEAGKHRVVFADDAGALAKGPELFFNLATQGLSEGAYV
RRFRYAEAVSTAEVELKDYCFKTPAYGLSHKKTSNELEHQRESYQHFDYPGRFKQDPSGKAFTGYRLDAL
RADAITGVGESNAAELRPGSAFTLTEHPNPSFNLAWQVVAVTHSGQQPQALEEESGGEPTTLSNSFEVVK
GSTTWRAALPYKPMVDGPQIATVVGPAGEEIYCDKFGRVKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVVVSFLEGDPDQPLITGRTFHATNPTPYVLPEHKTRTTLRTDTHKGSGFNELRFEDEAT
REQIYLHAQKDMDAVINNIHRQSVGLDQHLSVANDQFQRVDRHSHRTIGQDDFEQIGQDHHQSIGRHLVQ
SITQSFKRFIGGGEITRIEGSRQTTLSGSEETLIGAHQRVLVNTDSYLKAADIVLEAGQSLTIKAPGGFI
KIDGAGVTISGTVVKINDGGSAGAGTAPVSIEPEAPTRPTLPDAPDRR
-
Nucleotide Sequence: 2037 bp     [Download]
>gi|307128764|ref|NC_014500.1|:1555504-1557540 Dickeya dadantii 3937 chromosome, complete genome
GTGGCCAACAGTACAGGATTGCAGTTTACCGTGAAAATCGGCGCATTGGCGGACACCACCTTCGCGGTGG
TGGATTTCGAACTGAGCGAGGCGCTGAACCAGCCGTTTGCGCTGTCGCTGAGTCTCGCCAGCAGTCAGGT
CGATATCGATTTCGGCGCGGTGCTGGACCAGCCGTGCGAGCTGATGGTGTGGTACGAAGGCGCACTGCAG
CGACGGGTCAGCGGCATCGTCAGCCGTTTTGCTCAGGGCGACACCGGCTTTCGCCGCACCCGCTATCAGG
CCGAGGTGCGCCCGGCGCTGTGGCGGCTGGGGCTGCGCACCAACGCCCGTATCTTCCAGACCAAAAAGCC
GGATGAGATCATCACGCAATTGTTGCAGGAAGCCGGTATCAGCGACTTTGCTTTTTCGCTGCGCCACGAG
CACGCGGTGCGCGAATACTGTGTGCAGTACCGCGAAAGCGACCTGACGTTCATCAACCGGCTGGCGGCGG
AAGAGGGGATGTTCTACTTCCACGAGTTTGAGGCCGGCAAGCACCGGGTGGTGTTTGCCGACGACGCCGG
CGCGTTAGCTAAAGGCCCCGAGCTGTTCTTCAATCTCGCCACGCAAGGGTTGTCGGAAGGGGCATATGTG
CGCCGTTTCCGCTACGCCGAAGCGGTAAGCACCGCCGAGGTGGAACTGAAAGATTACTGTTTCAAAACCC
CGGCCTACGGGCTGTCGCACAAGAAGACCAGTAACGAGCTGGAGCACCAGCGCGAATCCTACCAGCACTT
CGACTACCCCGGCCGTTTTAAGCAAGATCCGAGCGGCAAGGCGTTTACCGGCTACCGGCTGGACGCGCTG
CGTGCGGATGCGATAACCGGTGTAGGGGAGTCCAACGCCGCCGAACTGCGGCCGGGCAGCGCCTTTACCC
TGACTGAACACCCGAACCCGTCGTTCAACTTGGCCTGGCAGGTGGTGGCGGTGACCCACAGCGGCCAGCA
GCCGCAGGCGCTGGAAGAGGAAAGCGGCGGTGAGCCGACCACGCTCAGCAACAGCTTTGAGGTGGTGAAA
GGATCCACCACCTGGCGCGCGGCGCTGCCGTACAAGCCGATGGTGGACGGCCCGCAGATTGCGACGGTGG
TAGGCCCGGCGGGCGAAGAGATTTACTGCGATAAATTTGGCCGGGTGAAGCTGCAATTCCCGTGGGACCG
CTACGGCGCCAGCGACGACCAGAGCTCCTGCTGGGTGCGGGTCAGCCAGGGCTGGGCCGGCGGCCAGTAC
GGCTTAATCGCCATTCCGCGCATCGGTCATGAAGTGGTGGTGAGCTTTCTGGAGGGCGACCCGGACCAGC
CGCTCATCACCGGCCGGACGTTCCATGCCACCAACCCCACGCCGTATGTGCTGCCGGAGCACAAAACACG
CACTACGCTGCGTACCGATACCCACAAAGGCAGCGGTTTCAACGAACTTCGTTTCGAAGATGAGGCCACC
CGGGAGCAGATTTACCTGCACGCACAGAAAGACATGGACGCGGTGATCAACAACATTCATCGCCAGAGCG
TCGGGTTGGATCAGCATCTGAGTGTGGCGAACGACCAGTTTCAGCGGGTGGATCGCCATAGCCATCGCAC
CATCGGGCAGGATGATTTTGAACAGATTGGGCAGGACCATCATCAATCGATTGGTCGCCATCTCGTACAG
AGCATCACTCAGTCATTCAAGCGCTTTATCGGCGGCGGCGAGATCACCCGTATTGAAGGCAGCCGCCAGA
CTACGCTGTCTGGTTCGGAAGAGACGCTGATCGGCGCGCATCAGCGGGTGCTGGTCAATACCGACAGCTA
CCTCAAGGCGGCGGATATCGTGCTGGAAGCCGGGCAGTCGCTGACTATCAAAGCACCCGGCGGGTTTATC
AAAATCGACGGCGCCGGCGTCACCATCTCCGGCACGGTGGTGAAAATCAACGACGGCGGTTCCGCAGGAG
CGGGCACGGCGCCGGTGTCGATCGAGCCGGAGGCCCCCACCAGACCGACGCTGCCAGATGCGCCGGACCG
GCGTTAA