SecReT6
Effector Protein ID: 307131672
-
SecReT6 ID409
T6SS typeA1
Gene symbol-
Locus tagDda3937_02773
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]3131418..3135728 [-]
ProductRhs-family protein
Effector typeProtein
Homologous effectorDda3937_02773
DescriptionRhsB
UniProt IDE0SIS2
KEGG IDddd:Dda3937_02773
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 410..429
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 466..493
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 486..513
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 553..585
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 592..627
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 612..647
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 633..669
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 654..688
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 676..711
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 730..756
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 766..799
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 806..842
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 847..879
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 887..922
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 940..974
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 972..992
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 1005..1024
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 1011..1040
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 1065..1094
RHS_repeat [PF05593], Evalue: 1.10E-52, Aligned region: 1112..1140
PAAR_motif [PF05488], Evalue: 1.00E-17, Aligned region: 9..22
PAAR_motif [PF05488], Evalue: 1.00E-17, Aligned region: 113..178
DUF4595 [PF15283], Evalue: 2.30E-06, Aligned region: 463..510
DUF4595 [PF15283], Evalue: 2.30E-06, Aligned region: 505..613
DUF4595 [PF15283], Evalue: 2.30E-06, Aligned region: 588..625
DUF4595 [PF15283], Evalue: 2.30E-06, Aligned region: 648..678
DUF4595 [PF15283], Evalue: 2.30E-06, Aligned region: 777..799
DUF4595 [PF15283], Evalue: 2.30E-06, Aligned region: 865..950
DUF4595 [PF15283], Evalue: 2.30E-06, Aligned region: 1002..1070
DUF4595 [PF15283], Evalue: 2.30E-06, Aligned region: 1094..1170
RHS [PF03527], Evalue: 0.0043, Aligned region: 439..445
RHS [PF03527], Evalue: 0.0043, Aligned region: 568..581
RHS [PF03527], Evalue: 0.0043, Aligned region: 634..646
RHS [PF03527], Evalue: 0.0043, Aligned region: 1055..1065
RHS [PF03527], Evalue: 0.0043, Aligned region: 1205..1223
HNH [PF01844], Evalue: 0.0066, Aligned region: 1381..1404
Protein Sequence: 1436 a.a.     [Download]
>gi|307131672|ref|YP_003883688.1| unnamed protein product [Dickeya dadantii 3937]
MLNDILSRVARVGAMHAGNRPNPPADRPQPCQGKPPTSPGKTIKHKSFLGALAGAVAGALVAAAVAAAAV
FLVGVTGGLAVAAVGALAVFAAGDLISAVTNKVSAVVDSASPAFGPVASGSGNVFVEKQPVARATKDTVA
CTKHNSPQLIAQGSESVFVNDAPAARIDDKTVCGATLKEGASTVFFGSGQGTYLEIADEFSWWEKALLIA
VEFLVPPSRGMLKGLGKLFTRNGLKSVLKGAKAGALFITKVPGKMGCAARAFKANKGMARFKEAAKAFKK
DPVYLASGEVIESRTDIELGQTLPLVFERTYRSASAHTGLLGRGWHDSWSEVATVTHDGLNTHVVITLAQ
GYDIDFTFHQDVQAVYCPHYPEFTLHRRGDGFSLWHRDQQTWRDFSVVQGERRLLSAIHDSHDNRIELVR
DPKGYLRQLRHSDGVTLLLVWQGEYLHQIQRIDGGQKTLLAEYRQDEQGRLVEANATHAYHLYYEYNTAH
RLTRWHDNDQTWARYEYDAQGRCVYTTCADGFLTARFDYLPDRVVMTDGLGQRSEFGFNDLHLMSWEQSP
LGHITRYEYDEVGNLLREISPAGRVVEFTYLDDTGRVSTFTDGSGHQWQYDYDDAQRLCGVTDPLGREWG
WVYDAEGNPERLTGPDASEVRFTWNRYGLLTQVSDAAGEVQARLQYDHRQRLLSATDAESRTRQLRYDRQ
DRVVQWQRADGARFRLGYRRASWTLPEQLIRPDDKEEQRQYDRHNNLLSYVDGNGALWRQTFGPFDLLTA
RTDAEGRTWRYEYDRESQQLIAVTAPDGSRWQWWLDADGRVIRERDMTGTETHYGYDEDGLCIRVRNGEG
DTRHFLYDARGLLLRETAPDDTLHYRYDAAGRLTEVSSATAHVQLDYDLRDRVVREWHNGTLLTRQYDDA
ARTVTRTLTWDGDADDTTGTLAPLTSLFHYTRTGELRQVQLPDGADLTLTHDAAGRESLRTGGSGFVQQR
EYDVMGWLTREQSGAQHDGRLQPAQTREYRYDGAGNLTGVRHNRDAEGYRLDATGRVQEMLSGGAGKPVD
TTARFHYTRTGLPQEAGRLTEWQAGRLVQHDDTHYQYDRAGRLIRKQVVQPGYRPQVWQYRWDSRNQLRV
VDTPNGERWLYRYDPFGRRVGKRCDQKAEETRYLWDGDQIAEIRHYRHGQLIQRRHWVYNGWELVVQQRQ
HTGGDWETDFVTSSQNGTPQALFTPDGTLRWQVPKATLWGQRQTEKSESPDPGLAFAGQLRDSESGLCYN
RFRYYDPAGGCYVSPDPIGIAGGESNYGYVQNPNTRVDPLGLAGCAMGEILADADKWSLAKIGDRQKGMI
KDKLSTVKERSKALNTKMREHFNANEQKIISEWEKQTGMNWPTLSSGSRATPHHVIPIKNGGSNEWWNII
PVQHPHTGTIHGTGSALRTHLPYQKDGGKLWNLLGY
-
Nucleotide Sequence: 4311 bp     [Download]
>gi|307128764|ref|NC_014500.1|:c3135728-3131418 Dickeya dadantii 3937 chromosome, complete genome
ATGCTCAACGATATTCTGAGCCGGGTGGCCCGGGTCGGGGCCATGCACGCCGGTAACCGCCCCAATCCGC
CCGCCGACCGTCCGCAGCCCTGTCAGGGCAAACCGCCGACCTCGCCGGGCAAGACCATCAAGCACAAGAG
TTTTCTCGGCGCGCTGGCCGGCGCCGTAGCCGGGGCGCTGGTCGCCGCGGCCGTAGCGGCCGCGGCGGTG
TTTCTGGTCGGCGTCACCGGCGGACTGGCGGTGGCGGCCGTCGGGGCACTGGCCGTGTTTGCCGCCGGCG
ACCTGATTTCCGCCGTCACCAACAAGGTCTCGGCGGTGGTGGACAGTGCGTCACCGGCCTTCGGGCCGGT
GGCGTCCGGCTCGGGTAACGTGTTTGTCGAAAAACAGCCGGTGGCCCGCGCCACGAAAGACACCGTCGCC
TGCACCAAGCACAACAGCCCGCAACTGATTGCGCAGGGCAGCGAGTCGGTGTTCGTGAACGACGCGCCGG
CCGCCCGTATCGACGACAAGACCGTGTGCGGCGCCACCCTCAAGGAAGGGGCGTCGACGGTATTCTTTGG
CTCCGGTCAGGGCACTTATCTGGAGATTGCCGACGAATTCAGTTGGTGGGAAAAAGCCCTGCTGATTGCG
GTGGAGTTTCTGGTGCCGCCCAGCCGGGGGATGTTGAAGGGACTGGGAAAGCTGTTTACCCGCAATGGTC
TGAAGAGTGTCTTAAAGGGCGCGAAGGCCGGGGCGCTGTTTATCACCAAAGTCCCTGGGAAAATGGGGTG
TGCCGCCAGGGCGTTTAAAGCCAATAAAGGCATGGCCAGATTCAAAGAAGCCGCTAAAGCTTTCAAAAAA
GACCCGGTGTACCTTGCCAGCGGCGAGGTGATTGAATCCCGTACCGATATCGAACTGGGTCAGACGCTGC
CGCTGGTGTTCGAGCGCACCTACCGCTCCGCCTCGGCGCACACCGGGCTGCTGGGCCGCGGCTGGCACGA
CAGCTGGAGCGAGGTGGCGACGGTGACGCACGACGGCCTCAACACCCACGTGGTCATCACGCTGGCACAA
GGCTACGACATCGATTTCACCTTCCATCAGGACGTACAGGCGGTGTACTGCCCGCATTACCCTGAATTTA
CCCTGCACCGCCGGGGCGACGGCTTCAGCCTGTGGCACCGTGACCAGCAGACCTGGCGCGACTTTAGCGT
GGTACAGGGCGAGCGCCGGCTGCTGTCGGCCATTCACGATAGCCACGACAACCGTATTGAGCTGGTGCGC
GACCCCAAAGGTTACCTGCGCCAGTTGCGCCACAGCGACGGCGTCACCCTGCTGCTGGTGTGGCAGGGCG
AGTACCTTCACCAGATACAACGCATCGATGGTGGCCAGAAGACGTTGCTGGCTGAGTACCGCCAGGACGA
ACAGGGCCGACTGGTGGAAGCCAACGCCACCCACGCCTATCACCTTTATTACGAGTACAACACCGCCCAT
CGGCTGACCCGCTGGCACGATAACGACCAGACCTGGGCGCGCTACGAATACGACGCACAGGGGCGCTGTG
TCTACACCACCTGTGCCGACGGCTTTCTGACCGCCCGTTTCGATTACCTCCCCGACCGGGTGGTGATGAC
CGATGGCCTCGGCCAGCGCAGCGAATTCGGCTTTAACGACCTGCACCTGATGAGCTGGGAACAATCCCCG
CTCGGTCACATCACCCGCTACGAGTACGACGAGGTCGGCAACCTGCTGAGGGAAATCTCGCCCGCCGGGC
GGGTGGTCGAATTCACCTATCTGGACGATACCGGGCGGGTCAGCACCTTTACCGACGGCAGCGGCCATCA
GTGGCAGTACGACTACGACGACGCGCAGCGGCTGTGCGGCGTCACCGACCCGCTGGGACGCGAGTGGGGC
TGGGTGTACGACGCTGAAGGCAACCCGGAGCGGCTCACCGGCCCGGATGCCAGCGAGGTACGATTCACCT
GGAACCGCTACGGCCTGCTGACCCAGGTCAGCGACGCCGCCGGTGAGGTGCAGGCGCGGTTGCAGTACGA
CCACCGTCAGCGGCTGCTGAGCGCCACCGATGCCGAGAGCCGCACCCGGCAGTTGCGCTACGACAGGCAG
GACCGGGTGGTGCAGTGGCAACGTGCGGACGGCGCCCGTTTCCGGCTTGGCTACCGCCGGGCCAGCTGGA
CGCTGCCGGAGCAGTTGATACGCCCGGATGACAAGGAAGAGCAGCGCCAGTACGACCGCCACAACAACCT
GCTGAGCTACGTGGACGGCAACGGCGCGTTATGGCGTCAGACCTTCGGTCCGTTCGACCTGCTGACCGCG
CGCACCGACGCCGAAGGCCGTACCTGGCGCTACGAGTACGACAGGGAAAGCCAGCAGTTGATTGCCGTCA
CCGCGCCGGACGGCAGCCGCTGGCAGTGGTGGCTGGACGCCGACGGGCGGGTCATCCGTGAGCGCGACAT
GACCGGCACCGAGACGCATTACGGCTACGACGAGGACGGCCTGTGCATCCGCGTGCGCAACGGCGAAGGC
GACACCCGTCACTTCCTGTACGACGCCCGCGGGCTGCTGCTGCGTGAGACCGCGCCGGACGACACCCTGC
ACTACCGGTATGATGCGGCAGGCCGTCTGACCGAGGTCTCGTCGGCCACCGCCCATGTGCAACTGGACTA
CGACCTGCGCGACCGGGTGGTACGCGAATGGCACAACGGCACGCTGCTCACCCGCCAGTACGATGACGCG
GCCCGCACCGTCACCCGCACCCTGACCTGGGACGGCGACGCCGATGACACCACCGGCACCCTCGCGCCGC
TCACCAGCCTGTTCCATTACACCCGCACCGGCGAACTGCGGCAGGTGCAGTTGCCGGACGGTGCCGACCT
GACCCTGACCCATGATGCGGCAGGCCGCGAGTCGCTTCGTACCGGCGGCAGCGGTTTTGTCCAGCAGCGG
GAATACGACGTGATGGGCTGGCTGACGCGGGAGCAGAGCGGCGCGCAGCACGACGGCCGCCTGCAACCAG
CGCAGACGCGGGAATACCGCTACGACGGTGCCGGTAACCTGACCGGGGTGCGGCATAACCGCGACGCCGA
AGGTTATCGTCTGGACGCCACCGGCCGGGTGCAGGAGATGCTGAGCGGCGGGGCGGGCAAACCGGTAGAC
ACCACCGCCCGCTTCCACTACACCCGCACCGGTCTGCCGCAGGAGGCAGGCCGCCTCACCGAATGGCAGG
CGGGCAGACTGGTTCAGCACGATGACACCCATTACCAGTACGACAGGGCCGGACGCCTTATCCGTAAACA
GGTGGTGCAGCCGGGCTACCGCCCGCAGGTGTGGCAGTACCGCTGGGACAGTCGCAACCAACTGCGGGTA
GTAGATACCCCGAACGGCGAACGCTGGCTGTACCGCTACGACCCGTTCGGTCGCCGGGTGGGCAAACGCT
GCGACCAGAAAGCCGAAGAGACCCGCTACCTGTGGGACGGCGACCAGATAGCGGAAATCCGCCACTACCG
CCATGGCCAACTGATACAACGCCGTCACTGGGTGTACAACGGCTGGGAGCTGGTGGTGCAGCAGCGCCAG
CACACCGGCGGCGACTGGGAAACGGATTTTGTGACCAGCAGCCAGAACGGCACCCCGCAGGCGCTGTTTA
CACCGGACGGCACCCTGCGCTGGCAGGTACCGAAAGCCACGCTGTGGGGCCAGCGTCAGACAGAAAAATC
GGAAAGTCCGGACCCCGGCCTGGCCTTCGCCGGGCAGCTCCGTGACAGCGAAAGCGGGCTGTGCTATAAC
CGCTTTCGGTACTACGACCCGGCCGGTGGGTGTTATGTCTCGCCAGACCCGATAGGGATAGCAGGGGGGG
AAAGTAATTACGGTTATGTCCAGAATCCCAATACTCGTGTAGATCCACTGGGGTTGGCTGGATGTGCAAT
GGGAGAAATATTAGCTGATGCTGACAAATGGTCGTTAGCAAAAATCGGCGATCGTCAAAAGGGAATGATT
AAAGACAAGCTCTCTACTGTAAAAGAAAGATCAAAAGCATTGAACACCAAGATGCGAGAACACTTTAATG
CAAATGAACAAAAAATAATCAGTGAGTGGGAAAAACAGACAGGGATGAATTGGCCCACGCTTTCAAGTGG
CAGTAGGGCAACGCCTCACCATGTTATTCCGATTAAGAATGGTGGTTCTAATGAGTGGTGGAATATAATA
CCTGTACAACATCCACATACAGGAACTATACATGGAACAGGCTCTGCACTTAGGACTCATCTTCCTTATC
AAAAAGATGGGGGGAAGCTATGGAATTTATTAGGTTATTAG

Reference
(1) Koskiniemi S et al. (2013). Rhs proteins from diverse bacteria mediate intercellular competition. Proc Natl Acad Sci U S A. 110(17):7032-7. [PudMed:23572593] experimental
 
experimental experimental literature