SecReT6
Effector Protein ID: 307131674
-
SecReT6 ID409
T6SS typeA1
Gene symbol-
Locus tagDda3937_02771
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]3136161..3138014 [-]
ProductRhs accessory genetic element
Effector typeProtein
Homologous effectorECA3427
Descriptiontype VI secretion system Vgr family protein
UniProt IDE0SIS4
KEGG IDddd:Dda3937_02771
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.60E-67, Aligned region: 30..328
Phage_GPD [PF05954], Evalue: 1.60E-67, Aligned region: 517..565
Phage_base_V [PF04717], Evalue: 5.60E-23, Aligned region: 367..459
Gp5_C [PF06715], Evalue: 2.60E-05, Aligned region: 501..523
Gp5_C [PF06715], Evalue: 2.60E-05, Aligned region: 524..546
Gp5_C [PF06715], Evalue: 2.60E-05, Aligned region: 557..573
Protein Sequence: 617 a.a.     [Download]
>gi|307131674|ref|YP_003883690.1| unnamed protein product [Dickeya dadantii 3937]
MANSTGLQFTVKVGALPDTTFAVVDFELSEALNQPFALSLNLASSQPGIDFGAVLDQPCELLVWYEGELQ
RRVSGIVSRFAQGDTGFRRTRYQAEVRPALWRLGLRTNARIFQTQKPDAIISTLLEEAGITDYAFALRHD
HAVREYCVQYRESDLAFINRLAAEEGLFYFHEFEAGKHRVVFADDAGALAKGPELFFNLATQGLSEGAYV
RRFRYAEAVSTAEVALKDYSFKTPAYGLLHNKMSSELAHQRESYQHFDYPGRFKQDPSGKAFTGYRLDAL
RAGAMTGNGESNAAELRPGSSFTLTEHPNPAFNLAWQVVAVAHSGQQPQALEEESGGEPTTLSNSFEVVK
ATTTWRAALPYKPMVDGPQIATVVGPAGEEIYCDEFGRVKLQFPWDRYGASDDQSSCWVRVSQGWAGGQY
GLIAIPRIGHEVVVSFLEGDPDQPIVTGRTFHATNPSPYPLPASKTRTSLRTSTHKGAGFNELRFEDQAG
QEEVFIHAQKDMNTVVLNNRSTSVNASHTENVGGDQTVVVQHNQTVSVKENQVTEIQGEQTVAVTKNRHT
TVDDNESLQVKKNIAIQSQSGDVLIATAGGFIAIDKDGNISITGKGLVLNGTRIDLN
-
Nucleotide Sequence: 1854 bp     [Download]
>gi|307128764|ref|NC_014500.1|:c3138014-3136161 Dickeya dadantii 3937 chromosome, complete genome
GTGGCCAACAGTACCGGATTACAGTTTACCGTGAAGGTCGGCGCGTTGCCGGACACCACCTTCGCGGTGG
TGGATTTTGAACTGAGCGAGGCGCTGAACCAGCCGTTTGCGCTGTCGCTCAATCTGGCCAGCAGCCAGCC
CGGCATCGATTTCGGCGCGGTGCTGGACCAGCCGTGCGAGCTGCTGGTGTGGTACGAAGGCGAGTTGCAG
CGCCGGGTCAGCGGTATCGTCAGCCGCTTTGCCCAGGGCGACACCGGTTTTCGCCGCACCCGCTATCAGG
CCGAAGTGCGCCCGGCGCTGTGGCGACTGGGCTTGCGCACCAACGCCCGTATTTTCCAGACCCAAAAACC
GGACGCGATTATCAGTACCCTGCTGGAAGAAGCGGGTATTACCGATTACGCCTTTGCCCTGCGCCATGAC
CACGCGGTGCGCGAGTACTGCGTGCAGTACCGCGAGAGCGACCTGGCGTTCATCAACCGGCTGGCGGCGG
AAGAAGGGCTGTTCTACTTCCACGAATTCGAAGCCGGCAAGCACCGGGTGGTGTTTGCCGACGACGCCGG
CGCGTTAGCCAAAGGCCCCGAGCTGTTCTTCAATCTCGCCACACAAGGGTTGTCGGAAGGCGCTTATGTG
CGCCGTTTCCGTTACGCCGAAGCGGTGAGCACCGCCGAGGTGGCGCTGAAGGACTACAGCTTCAAAACCC
CGGCCTACGGGCTACTGCACAACAAGATGAGCAGCGAGCTGGCGCACCAGCGCGAGTCCTACCAGCACTT
CGACTACCCCGGTCGCTTCAAGCAGGACCCGAGCGGCAAGGCGTTTACCGGCTACCGGCTGGACGCCCTG
CGCGCCGGGGCGATGACCGGCAACGGCGAATCCAACGCCGCCGAACTGAGGCCGGGCAGCAGCTTTACCC
TGACCGAGCACCCGAACCCGGCGTTCAATCTGGCCTGGCAGGTGGTGGCGGTGGCCCACAGCGGCCAGCA
GCCGCAGGCGCTGGAGGAGGAAAGCGGCGGCGAGCCGACCACGCTCAGCAACAGCTTCGAGGTGGTGAAA
GCCACCACCACCTGGCGGGCGGCACTGCCGTACAAGCCGATGGTGGACGGCCCGCAGATTGCCACCGTGG
TCGGCCCGGCGGGTGAGGAGATTTACTGCGACGAATTTGGCCGGGTGAAACTGCAGTTCCCGTGGGACCG
CTACGGTGCCAGCGACGACCAGAGCTCCTGCTGGGTGCGGGTCAGTCAGGGCTGGGCCGGTGGTCAGTAC
GGGTTAATCGCCATTCCGCGCATCGGTCACGAGGTGGTGGTGAGCTTTCTGGAGGGTGACCCGGACCAGC
CCATCGTCACCGGGCGCACCTTCCACGCCACCAACCCGTCGCCGTATCCGCTGCCGGCCAGCAAGACCCG
CACCTCGCTGCGCACCAGTACCCATAAAGGGGCCGGGTTCAACGAGCTGCGCTTTGAAGACCAGGCCGGG
CAGGAGGAGGTGTTTATCCATGCCCAGAAGGACATGAACACGGTGGTGCTGAACAACCGCAGTACGTCGG
TCAACGCCAGTCACACCGAAAACGTGGGCGGCGACCAGACGGTGGTGGTGCAACACAACCAGACGGTGTC
GGTGAAGGAAAATCAGGTCACCGAGATTCAGGGCGAGCAGACCGTCGCCGTCACCAAAAACCGCCACACC
ACCGTCGATGACAACGAGTCGCTGCAGGTGAAAAAAAATATCGCCATCCAGTCCCAGAGCGGCGATGTCC
TCATTGCCACCGCCGGCGGCTTCATCGCCATCGACAAGGACGGCAACATTTCCATTACCGGTAAAGGACT
GGTGCTGAACGGCACCCGTATCGATTTGAACTGA