SecReT6
Effector Protein ID: 307131675
-
SecReT6 ID409
T6SS typeA1
Gene symbol-
Locus tagDda3937_02770
StrainDickeya dadantii 3937
Repliconchromosome [GenBank: NC_014500] [Browse all T6SS(s) in this replicon]
Location [Strand]3138127..3138645 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorECA4275
DescriptionHcp protein
UniProt IDE0SJG0
KEGG IDddd:Dda3937_02770
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.10E-37, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|307131675|ref|YP_003883691.1| unnamed protein product [Dickeya dadantii 3937]
MPTPCYISIEGKTQGNITAGAFTSDSVGNIYVQGHEDEMLVQEFNHVVTVPTDPQSGQPSGQRVHKPFKF
TVALNKAVPLLYNALASGEMLPTVTLKWYRTSVEGKQEHFFTTTLTDATIVDINNQMPHCQDPSKQDYTQ
LIEVSLAYRKVDWEHTVAGTSGSDDWRAPIEA
-
Nucleotide Sequence: 519 bp     [Download]
>gi|307128764|ref|NC_014500.1|:c3138645-3138127 Dickeya dadantii 3937 chromosome, complete genome
ATGCCAACTCCATGCTATATCAGCATCGAAGGGAAAACCCAGGGCAACATCACCGCCGGTGCCTTCACCT
CCGATTCCGTCGGCAACATCTACGTGCAGGGCCACGAAGATGAGATGCTGGTGCAGGAATTCAACCACGT
CGTGACCGTGCCGACCGACCCGCAGTCCGGCCAGCCGTCCGGTCAGCGCGTGCACAAGCCGTTCAAGTTC
ACCGTCGCCCTGAACAAGGCCGTGCCGCTGCTGTATAACGCGCTGGCGTCCGGCGAAATGCTGCCGACCG
TGACCCTGAAGTGGTACCGCACGTCTGTCGAAGGCAAGCAGGAGCACTTCTTCACCACCACCCTGACCGA
TGCCACCATCGTCGACATCAACAACCAGATGCCGCACTGCCAGGACCCGTCCAAGCAGGATTACACCCAG
CTGATCGAAGTGTCGCTGGCCTACCGCAAGGTGGACTGGGAGCACACTGTCGCCGGCACTTCCGGCTCTG
ACGACTGGCGCGCGCCGATCGAAGCGTAA