SecReT6
Effector Protein ID: 307545519
hcp7
SecReT6 ID410
T6SS typeA1
Gene symbolhcp7
Locus tagHELO_2929
StrainHalomonas elongata DSM 2581
Repliconchromosome [GenBank: NC_014532] [Browse all T6SS(s) in this replicon]
Location [Strand]2259074..2259592 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorECA2866
DescriptionHcp protein
UniProt IDE1V3Y4
KEGG IDhel:HELO_4078, hel:HELO_2929
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.50E-36, Aligned region: 6..156
Protein Sequence: 172 a.a.     [Download]
>gi|307545519|ref|YP_003897998.1| hcp7 gene product [Halomonas elongata DSM 2581]
MPTPCYISIEGQTQGNITAGAFTPESVGNIYVEGHEDEMLVQEFKHIVTVPTDPQSGQPSGQRAHKPFIF
TVALNKAVPLLYNALASGEMLPTVELKWYRTSVEGKQEHFFTTALTDATIVDINLRMPHAQDANSAEFTQ
LMDVSLAYRKIDWEHTVAGTSGSDDWRAPIEG
-
Nucleotide Sequence: 519 bp     [Download]
>gi|307543589|ref|NC_014532.1|:c2259592-2259074 Halomonas elongata DSM 2581 chromosome, complete genome
ATGCCAACCCCATGTTATATCAGCATCGAAGGCCAGACTCAGGGCAACATCACCGCTGGCGCCTTCACGC
CCGAATCCGTGGGCAACATCTACGTCGAAGGCCATGAAGACGAGATGCTCGTCCAGGAATTCAAGCACAT
CGTCACTGTGCCGACGGATCCGCAGTCCGGTCAGCCGTCCGGTCAGCGTGCTCACAAGCCGTTCATCTTC
ACCGTGGCCCTGAACAAGGCCGTGCCGCTGCTGTACAACGCCCTGGCGTCCGGTGAGATGCTGCCCACGG
TCGAGCTGAAGTGGTACCGCACCTCCGTAGAAGGCAAGCAGGAGCACTTCTTCACCACCGCCCTGACCGA
TGCCACCATCGTCGACATCAACCTGCGCATGCCCCATGCTCAGGACGCCAACAGCGCCGAGTTCACTCAG
CTGATGGACGTCTCCCTGGCCTACCGCAAGATCGACTGGGAGCACACCGTCGCCGGCACTTCCGGTTCCG
ACGACTGGCGCGCCCCGATCGAAGGCTAA