SecReT6
Effector Protein ID: 307728582
-
SecReT6 ID495
T6SS typeA2
Gene symbol-
Locus tagBC1003_0512
StrainBurkholderia sp. CCGE1003
Repliconchromosome I [GenBank: NC_014539] [Browse all T6SS(s) in this replicon]
Location [Strand]573308..573793 [-]
Producttype VI secretion system effector
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDE1T8C4
KEGG IDbgf:BC1003_0512
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.20E-39, Aligned region: 6..147
Protein Sequence: 161 a.a.     [Download]
>gi|307728582|ref|YP_003905806.1| type VI secretion system effector [Burkholderia sp. CCGE1003]
MAIPAYMWIKDDGGADIKGSVTVQGREGSVEVVALQHGVSIPTDSNTGKLTGTRVHLPITFTKETDASSP
YLYKAVTSGQTLKSIEIKWYKIDDAGKEKEYFNTKLDNVKVVAVNPKMHDIKNPEFEKHNHLEDVQLRYE
KITWSYKDGNIIHTDTWNERS
-
Nucleotide Sequence: 486 bp     [Download]
>gi|307728076|ref|NC_014539.1|:c573793-573308 Burkholderia sp. CCGE1003 chromosome 1, complete sequence
ATGGCAATTCCGGCATACATGTGGATCAAGGACGATGGCGGCGCCGACATCAAGGGTTCGGTCACCGTTC
AGGGTCGCGAAGGCAGCGTCGAAGTGGTGGCGCTTCAGCATGGCGTCAGTATTCCGACCGATTCGAACAC
CGGCAAACTGACCGGCACGCGCGTTCACCTGCCGATCACCTTCACGAAGGAGACGGACGCCTCGTCGCCG
TATCTGTACAAGGCCGTCACCAGCGGTCAGACGCTCAAGTCGATCGAGATCAAGTGGTACAAGATCGACG
ACGCGGGCAAAGAGAAAGAGTATTTCAACACCAAGCTCGACAACGTGAAGGTCGTGGCGGTGAACCCGAA
GATGCACGACATCAAGAACCCCGAGTTCGAAAAGCACAATCATCTCGAAGACGTGCAACTGCGCTACGAG
AAGATCACGTGGTCGTACAAGGACGGCAACATCATCCACACCGACACCTGGAACGAACGCTCCTGA