SecReT6
Effector Protein ID: 308186542
SecReT6 ID411
T6SS typeA3
Gene symbolhcp
Locus tagPvag_1031
StrainPantoea vagans C9-1
Repliconchromosome [GenBank: NC_014562] [Browse all T6SS(s) in this replicon]
Location [Strand]1084523..1085005 [+]
Producttype VI secretion system, effector protein hcp
Effector typeProtein
Homologous effectorSMA2263
DescriptionHcp protein
UniProt IDE1SAE9
KEGG IDpva:Pvag_1031
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.10E-39, Aligned region: 6..136
Peptidase_C14 [PF00656], Evalue: 0.0026, Aligned region: 52..153
Protein Sequence: 160 a.a.     [Download]
>gi|308186542|ref|YP_003930673.1| hcp gene product [Pantoea vagans C9-1]
MAIDMFMKVDGVTGESKDSNHTGWTDITSFSWGASQPGNMSVGGGGGAGKVNFNDLHVNALIDKSTTALL
KNCASGKHLTKVELSICKAGGSQVEYARITLEDVLVTAVNYNGSDNGDTLGMTYSFQASKVKQQYWEQSS
SGGKGAESSAGWDIKGNKEA
-
Nucleotide Sequence: 483 bp     [Download]
>gi|308185541|ref|NC_014562.1|:1084523-1085005 Pantoea vagans C9-1 chromosome, complete genome
ATGGCTATTGATATGTTTATGAAGGTTGACGGAGTCACCGGCGAGTCAAAAGACTCAAACCACACTGGCT
GGACTGATATTACCTCTTTCTCATGGGGTGCTTCTCAGCCAGGCAACATGTCTGTGGGCGGCGGCGGCGG
TGCGGGTAAAGTTAACTTCAACGACCTGCACGTGAATGCACTGATCGACAAATCCACCACTGCGCTGCTG
AAGAACTGCGCAAGCGGTAAGCATCTCACTAAAGTTGAACTCTCTATCTGTAAAGCGGGCGGTTCTCAGG
TTGAGTATGCGCGCATCACCCTGGAAGACGTTCTGGTGACCGCTGTGAATTACAATGGCTCCGACAACGG
CGATACCCTGGGAATGACCTACTCCTTCCAGGCATCCAAAGTGAAGCAGCAGTACTGGGAGCAGAGTTCT
TCCGGCGGCAAAGGCGCAGAAAGCAGCGCCGGCTGGGACATTAAAGGCAACAAAGAAGCGTAA