SecReT6
Effector Protein ID: 308186559
SecReT6 ID411
T6SS typeA3
Gene symbolrhs
Locus tagPvag_1048
StrainPantoea vagans C9-1
Repliconchromosome [GenBank: NC_014562] [Browse all T6SS(s) in this replicon]
Location [Strand]1105748..1110229 [+]
ProductRhs-family protein
Effector typeProtein
Homologous effectorECL_01567
DescriptionrhsA
UniProt IDE1SAG6
KEGG IDpva:Pvag_1048
PDB IDNA
Domain hit(s) vs Pfam RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 393..410
RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 431..444
RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 482..509
RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 555..576
RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 590..626
RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 654..690
RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 697..732
RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 720..751
RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 759..796
RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 784..816
RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 801..855
RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 868..894
RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 912..934
RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 920..955
RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 963..994
RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 1055..1086
RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 1106..1135
RHS_repeat [PF05593], Evalue: 1.10E-54, Aligned region: 1147..1162
PAAR_motif [PF05488], Evalue: 4.70E-15, Aligned region: 3..14
PAAR_motif [PF05488], Evalue: 4.70E-15, Aligned region: 99..129
PAAR_motif [PF05488], Evalue: 4.70E-15, Aligned region: 176..218
RHS [PF03527], Evalue: 4.20E-14, Aligned region: 736..752
RHS [PF03527], Evalue: 4.20E-14, Aligned region: 761..774
RHS [PF03527], Evalue: 4.20E-14, Aligned region: 932..946
RHS [PF03527], Evalue: 4.20E-14, Aligned region: 988..1009
RHS [PF03527], Evalue: 4.20E-14, Aligned region: 1116..1127
RHS [PF03527], Evalue: 4.20E-14, Aligned region: 1222..1261
DUF4150 [PF13665], Evalue: 0.00079, Aligned region: 107..126
DUF4150 [PF13665], Evalue: 0.00079, Aligned region: 170..215
D-aminoacyl_C [PF07908], Evalue: 0.0028, Aligned region: 106..122
D-aminoacyl_C [PF07908], Evalue: 0.0028, Aligned region: 188..210
Protein Sequence: 1493 a.a.     [Download]
>gi|308186559|ref|YP_003930690.1| rhs gene product [Pantoea vagans C9-1]
MDNPAARVGDEIIHSSIFADITSIVAEGAAYAVIGAAVGAAIVSAAPLLGTGAAAASVAAVGNSCLLSGI
LGGILANAVGLSQEISKAADGLGNMIFPPSPAGVISSGSDNVYVNGLLAVRAAGMLTPGETPPPEPQSPK
SFADYGGMLLSAVGQFGSAMWQPTVASADAGTSPLEQDKVACEKHSAPQYLAQGSKSVFINGQPAVRAKD
KTTCDATVSDDVSPNVIIGGETVTVREIKSGKVPGLAVMMIGLSLIRGRPSQILKNMPCALAGAVGGMAA
DMAINAAFSSLFPVHAATGVKVLNDDAERDFSLPGRFPLSFQRSYNSLTQRAGLFGQGWATVFDSYLTLE
GNRATWFDDNGRELSFDVPGEKEVLYSISEGLMVRRNESGDIAIADDDGAVWRLYRRTAADPQVLRLASL
SDEYGNALEMGWDEQARLVRIHDAPLAIDVTLHYDDKQHARRPTSASHFDGDQHWPLTRWTYTEEGQLAS
VTDAAGVVSRRFRYNDDGLMVWHQLPGGLESEYRWQKLDHWRVVENRTNTGDGCHMHYDLEAGITRVSTY
DGQQREHHWNAAGLITCFIDERGEKWRYEWDENELLTRRIDPLGNAVSFAYDELGNRVEEKDADGGVQAV
QWLSHRSLPTVVAGADGSTTKYYYDPHHGLERVVDALGQSTIYKRDESGLVVEEIDAAGNSYRREFNDAG
QVIRETDCSGLTTRYRYHPLGWLSSVTAPDGEETRYHYDAAGRPLQLERAEGWEERLHWSENGLPLAYES
ADGKRSEFRYDNVGRLIANRNAQGETVQRSWDSRGRLTALQNENGEQYQFEWGADSLLLAQMGLDGVATR
YDYDAAGRTLSRTFAAGHPQSITHRYHWSRAGQLLARTTPEGQTRYHYSGGGQLGKVSQHLPLSDTEWSQ
QAEQEITFEYDALGRIVAEQGEQGELAWAYDALGNCTALTLPDGRNLKQLYYGSGHLLSIALDNLPVTEF
TRDTLHRELSRTQGGLTMRSEYDRLGRLRRRDVFRGDSQRPAPRVWSRRRDFDYGNNLIREERDDNPFSQ
TLWNYDNAGRLLSQEGAQPGNEQWRWDGAGNPLDRHSSAHVTHNRVTELNGIRWQYDIHGRNTEKDDGHT
RWRYRYDGEHRLTEVISEPRDRNKPRTKVSFRYDPLGRRISKTIQQLLQGRPSGNVVTTRFVWEGYRLLQ
EIHDGTPLTYVYSDSQSYEPLARIDGVESPEIYWFHNAANGMPELLTDSEGQKAWEGINSPWGKLLRESS
QRMPVVQQNLRMQGQYLDRETGLHYNLFRYYDPDSGRFTQQDPIGLAGGINLYQYAPNALGWVDPWGLSR
CSSGNKDKPDFYVGPAGPSATLPATGYRYMRYLEDDGTINVWAPKVIETKAAPVTYFGFEKIKTGYDARD
AFQIKGKENFDPLDPLDKSWSDARLRGEFDTLQLYENGVPQVRHPRMFGDRDGAPLEPFTKAYPEYGAGN
IQQMYADNRIIEFDKVDILPERE
-
Nucleotide Sequence: 4482 bp     [Download]
>gi|308185541|ref|NC_014562.1|:1105748-1110229 Pantoea vagans C9-1 chromosome, complete genome
ATGGATAATCCTGCGGCCCGCGTGGGCGATGAGATCATTCACTCCAGCATTTTTGCTGATATCACCAGCA
TTGTGGCAGAAGGTGCGGCGTATGCCGTCATTGGTGCCGCAGTGGGTGCTGCTATCGTCTCGGCAGCGCC
CCTGCTGGGTACAGGGGCGGCAGCGGCGAGTGTAGCTGCCGTGGGTAACAGTTGCCTGCTCAGCGGTATT
CTTGGCGGTATACTGGCCAATGCCGTGGGTCTGTCACAGGAGATCAGCAAAGCGGCCGATGGGCTGGGAA
ACATGATATTCCCGCCGTCACCCGCCGGTGTGATATCCAGCGGTTCAGACAACGTTTACGTAAATGGTCT
TTTAGCCGTGCGCGCGGCCGGGATGCTCACGCCCGGCGAGACACCACCACCGGAACCGCAATCACCGAAG
AGCTTTGCCGACTACGGCGGCATGCTGCTCTCTGCGGTGGGCCAGTTTGGGAGTGCAATGTGGCAACCTA
CGGTCGCCTCCGCCGATGCGGGCACCTCTCCGCTGGAGCAGGACAAAGTGGCCTGTGAAAAACACAGTGC
ACCGCAATATCTGGCGCAGGGATCGAAAAGCGTCTTTATCAATGGCCAGCCAGCGGTGCGCGCAAAGGAT
AAAACCACCTGTGATGCCACCGTGAGTGACGATGTGTCCCCCAATGTCATTATTGGTGGTGAAACGGTCA
CGGTCAGGGAGATCAAAAGCGGCAAGGTGCCAGGCCTGGCTGTGATGATGATCGGCCTTTCTCTAATCCG
TGGTCGCCCCAGTCAGATCCTCAAAAACATGCCCTGCGCGCTGGCCGGTGCCGTGGGCGGTATGGCAGCG
GACATGGCCATCAACGCGGCTTTCTCGTCGCTGTTCCCGGTTCATGCGGCGACCGGCGTCAAAGTCCTGA
ATGATGATGCCGAGCGCGATTTTTCCCTTCCCGGACGTTTCCCGCTTAGTTTTCAGCGCAGCTATAACAG
CCTGACTCAGCGTGCTGGCCTGTTTGGTCAGGGCTGGGCCACGGTGTTTGACAGTTACCTGACGCTGGAA
GGGAATCGGGCGACCTGGTTTGATGACAACGGACGCGAACTAAGCTTTGACGTGCCCGGTGAAAAAGAGG
TGCTCTACAGCATCAGCGAAGGGTTGATGGTGCGGCGCAACGAGTCAGGCGATATCGCCATTGCCGATGA
CGACGGTGCGGTCTGGCGTCTATACCGACGCACTGCTGCTGATCCGCAGGTGCTTCGGCTGGCTTCACTG
AGTGATGAGTACGGCAACGCCCTGGAGATGGGCTGGGATGAACAGGCTCGTCTGGTGCGTATTCATGACG
CGCCGCTGGCGATTGACGTTACGCTGCACTACGACGACAAACAGCACGCGCGGCGCCCGACATCAGCCAG
CCATTTTGATGGCGATCAGCACTGGCCTCTGACGCGCTGGACATACACTGAAGAGGGCCAGCTTGCCAGC
GTTACTGATGCGGCTGGCGTTGTGTCGCGGCGTTTCCGTTACAACGACGACGGGTTGATGGTCTGGCATC
AGCTGCCCGGCGGGCTGGAAAGTGAATATCGCTGGCAGAAGCTGGATCACTGGCGCGTGGTTGAGAACCG
TACCAATACCGGTGACGGCTGCCATATGCATTACGATCTTGAGGCGGGCATCACGCGTGTGTCGACCTAT
GACGGTCAGCAGCGCGAACACCACTGGAATGCCGCGGGCCTCATCACCTGTTTTATTGATGAGCGGGGTG
AGAAGTGGCGCTATGAGTGGGATGAAAACGAACTCCTGACGCGTCGCATCGATCCGCTGGGCAATGCGGT
GAGCTTCGCCTATGACGAGCTGGGTAATCGCGTTGAAGAGAAAGATGCTGACGGCGGTGTGCAGGCGGTG
CAATGGTTGTCACACCGTTCGCTGCCCACGGTGGTTGCCGGAGCGGATGGTTCCACAACGAAATACTATT
ACGATCCCCATCACGGTCTTGAGCGCGTGGTTGATGCGCTCGGGCAAAGCACGATCTATAAACGGGATGA
GTCCGGGCTGGTTGTTGAGGAGATCGACGCAGCAGGTAACAGCTACCGCCGGGAGTTTAACGATGCGGGG
CAGGTTATCCGTGAAACCGACTGTTCAGGACTGACCACGCGCTACCGCTATCATCCCCTGGGTTGGCTCA
GCTCTGTCACCGCGCCGGATGGTGAAGAAACCCGTTATCACTATGATGCCGCAGGACGTCCTCTTCAGCT
GGAACGTGCAGAGGGATGGGAAGAGCGGTTGCACTGGAGTGAAAACGGACTGCCGCTGGCCTATGAGTCG
GCTGATGGCAAGCGCAGTGAATTTCGTTACGACAATGTCGGGCGACTGATTGCCAACCGCAATGCGCAGG
GTGAGACGGTTCAGCGAAGCTGGGATAGTCGTGGCCGGTTAACGGCGCTGCAAAACGAAAACGGCGAGCA
GTACCAGTTCGAGTGGGGCGCAGATTCTCTGTTACTGGCTCAGATGGGGCTGGATGGCGTTGCCACGCGA
TACGACTATGACGCGGCGGGCCGCACGTTATCACGCACCTTTGCCGCCGGACATCCTCAATCCATTACCC
ATCGTTACCACTGGAGCCGCGCGGGGCAATTACTGGCGCGAACCACGCCGGAAGGCCAGACGCGCTATCA
CTACAGCGGTGGTGGCCAGCTGGGTAAAGTGTCGCAGCATCTGCCGCTGTCTGACACCGAATGGAGCCAG
CAGGCCGAGCAGGAGATTACCTTTGAATATGATGCGCTGGGCCGCATTGTTGCTGAACAGGGGGAGCAGG
GCGAACTGGCGTGGGCTTATGACGCGCTGGGTAACTGTACGGCCCTGACGCTGCCCGATGGTCGCAACCT
GAAGCAGCTTTATTACGGTAGCGGCCATTTACTGAGCATCGCGTTAGACAACCTGCCGGTCACAGAATTT
ACCCGTGACACACTGCACCGGGAACTGAGCCGGACGCAGGGCGGGCTGACCATGCGCAGTGAGTACGATC
GGTTAGGCAGACTGCGCCGCCGTGACGTGTTCAGGGGTGACTCGCAGCGTCCTGCACCGCGCGTCTGGTC
CCGTCGGCGTGACTTCGATTACGGTAACAACCTGATCCGTGAAGAGCGTGACGATAATCCGTTCAGCCAG
ACATTATGGAACTACGATAACGCCGGCCGGCTGTTGTCACAGGAAGGCGCACAGCCGGGTAATGAGCAGT
GGCGCTGGGATGGCGCAGGCAATCCGCTGGATCGCCATAGTTCCGCTCATGTCACGCATAACCGCGTCAC
TGAACTGAACGGTATCCGCTGGCAGTACGATATTCATGGCCGCAACACTGAGAAAGATGACGGGCACACC
CGCTGGCGCTACCGTTACGATGGTGAGCATCGCCTGACGGAAGTGATCAGCGAGCCGCGGGACCGTAACA
AGCCGCGCACTAAGGTGAGTTTCCGCTACGATCCGCTGGGACGCCGCATCAGTAAAACCATCCAGCAGCT
GTTACAGGGAAGACCATCTGGCAACGTCGTAACGACGCGTTTTGTGTGGGAAGGCTACCGCCTGCTGCAG
GAAATCCACGACGGCACTCCGCTGACCTATGTTTACAGCGACAGCCAGAGCTATGAACCGCTGGCCCGTA
TTGATGGTGTGGAAAGCCCGGAGATTTACTGGTTCCATAATGCGGCCAACGGGATGCCGGAGCTGCTGAC
AGACAGTGAAGGGCAAAAAGCCTGGGAAGGGATAAACAGCCCGTGGGGCAAACTGCTGCGCGAGTCCAGC
CAGCGGATGCCTGTCGTTCAGCAGAACCTGCGTATGCAGGGCCAGTACCTGGACCGGGAAACCGGACTGC
ACTACAATCTGTTTCGATATTATGACCCGGACAGCGGACGGTTTACCCAGCAGGACCCGATAGGGCTGGC
GGGCGGGATCAACCTTTACCAGTATGCGCCGAATGCGCTGGGTTGGGTGGATCCGTGGGGATTGAGTAGG
TGTAGTAGTGGAAATAAGGATAAACCGGATTTCTATGTTGGGCCAGCAGGGCCAAGCGCAACGCTGCCTG
CAACAGGCTACCGTTATATGAGGTATCTTGAAGATGATGGAACTATAAACGTTTGGGCACCTAAAGTAAT
CGAAACAAAGGCCGCTCCAGTGACCTATTTCGGATTTGAAAAAATCAAGACAGGATATGATGCGCGTGAT
GCTTTCCAGATTAAAGGAAAAGAGAATTTTGATCCGTTAGATCCTTTAGATAAATCATGGAGTGATGCCC
GCCTCAGAGGTGAATTTGATACTTTACAACTTTACGAAAATGGCGTGCCACAAGTGCGTCATCCGCGAAT
GTTTGGCGATAGAGATGGAGCCCCTCTTGAACCATTCACCAAAGCGTACCCAGAATATGGTGCTGGAAAT
ATCCAACAAATGTATGCTGATAATAGAATAATAGAGTTCGATAAAGTCGATATTTTACCGGAGAGAGAAT
GA