SecReT6
Effector Protein ID: 32265742
-
SecReT6 ID47
T6SS typeA1
Gene symbol-
Locus tagHH0243
StrainHelicobacter hepaticus ATCC 51449
Repliconchromosome [GenBank: NC_004917] [Browse all T6SS(s) in this replicon]
Location [Strand]234543..235052 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorHH0243
DescriptionHcp protein
UniProt IDQ7VJK0
KEGG IDhhe:HH0243
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 9.60E-37, Aligned region: 6..155
Protein Sequence: 169 a.a.     [Download]
>gi|32265742|ref|NP_859774.1| unnamed protein product [Helicobacter hepaticus ATCC 51449]
MAQPAYIKIEGVTQGLISSGASTQESIGNRYQAGHEDEIMAQEISHIVTVPTDTQSGQPSGQRVHRPFIF
TCSLNKAVPLLYNALTKGERLNNVEVHWFRTSIGGGAEHYFTTKLEDAIITDIDLIMPNAQDTSNNNKTE
LFRVSLNYRKIIWEHVVAGTSGSDDWRNA
-
Nucleotide Sequence: 510 bp     [Download]
>gi|32265499|ref|NC_004917.1|:c235052-234543 Helicobacter hepaticus ATCC 51449 chromosome, complete genome
ATGGCGCAGCCAGCATATATTAAAATTGAAGGTGTTACACAAGGACTTATTTCTAGTGGGGCTTCTACGC
AAGAGAGCATAGGTAATCGTTACCAAGCAGGACACGAAGATGAAATTATGGCTCAAGAGATTTCTCATAT
TGTAACTGTTCCCACAGATACACAAAGCGGACAACCATCAGGTCAAAGGGTGCATAGACCCTTTATTTTT
ACCTGTTCTCTCAATAAAGCTGTTCCTTTACTTTACAATGCCCTCACAAAGGGTGAAAGATTAAACAATG
TAGAAGTACATTGGTTTAGGACATCAATAGGTGGTGGAGCAGAACATTACTTCACTACAAAATTAGAAGA
TGCTATTATTACAGACATAGACCTTATTATGCCAAATGCACAAGATACAAGCAATAATAACAAAACTGAG
CTCTTTAGGGTTTCTCTTAATTATCGAAAAATTATTTGGGAACATGTTGTTGCAGGAACGAGCGGAAGTG
ATGACTGGAGAAATGCTTAA

Reference
(1) Bartonickova L et al. (2013). Hcp and VgrG1 are secreted components of the Helicobacter hepaticus type VI secretion system and VgrG1 increases the bacterial colitogenic potential. Cell Microbiol. 15(6):992-1011. [PudMed:23278999] experimental
 
experimental experimental literature