SecReT6
Effector Protein ID: 32265790
-
SecReT6 ID47
T6SS typeA1
Gene symbol-
Locus tagHH0291
StrainHelicobacter hepaticus ATCC 51449
Repliconchromosome [GenBank: NC_004917] [Browse all T6SS(s) in this replicon]
Location [Strand]283450..284859 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorHH0242
DescriptionVgrG
UniProt IDQ7VJF2
KEGG IDhhe:HH0291
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 2.50E-12, Aligned region: 129..182
DUF3540 [PF12059], Evalue: 0.00086, Aligned region: 150..160
DUF3540 [PF12059], Evalue: 0.00086, Aligned region: 365..439
DUF2345 [PF10106], Evalue: 0.0013, Aligned region: 315..345
DUF2345 [PF10106], Evalue: 0.0013, Aligned region: 375..454
Protein Sequence: 469 a.a.     [Download]
>gi|32265790|ref|NP_859822.1| unnamed protein product [Helicobacter hepaticus ATCC 51449]
MSASNISHSYVNTLTLLPLPFSYTPSLKSKPKAPNSTLGIVIGQSEDIEGQRNTIHTDNFGRVKVRMNCF
ANQEVIDNARAKEQRNAQGNNAENNHHNTQANHPLTQENHTTNNDVDSNNSQTKAYSYHYSPYLRVSSPI
ASASSGFYHTPRVGDEVLISYLNNDIDMPIIIGSLYNPSNPALPPLPLNAHQTSLSARTLNNSSALQAEN
TNSHHNLIESGFNEITLSNLKEQEHIYLQAQRDYEELIKHNFLQTIHNNKESQVEGTYNERIKKIHTQTI
DLAKIVSIGGEYNTNVALSKDTIVGLSHTLNVGVDNKVRIAKKSSEYVGEDKEVEIGGNLNTSIKQDESR
NVGGNKREVVEGDSDISIEKKFNIQTQGEIAIHSNENIHLSSPQSLSLESDRAAVMVADNITMIADSNYL
LNANNEATIQVSDTSIVAKSDSIVIKAGGVEVVIDSKGLVVKGGEVKAE
-
Nucleotide Sequence: 1410 bp     [Download]
>gi|32265499|ref|NC_004917.1|:c284859-283450 Helicobacter hepaticus ATCC 51449 chromosome, complete genome
ATGAGTGCTTCAAACATATCTCACTCTTATGTCAATACTCTAACCCTTTTACCTCTCCCCTTTAGCTATA
CTCCCTCTTTAAAGAGTAAGCCTAAAGCTCCAAATAGCACTCTAGGAATTGTGATTGGGCAGAGTGAGGA
TATAGAAGGACAAAGAAATACTATTCATACAGATAACTTTGGCAGGGTGAAAGTAAGAATGAATTGCTTT
GCTAATCAAGAAGTTATAGATAATGCAAGAGCGAAAGAACAAAGAAATGCTCAAGGAAATAATGCAGAGA
ATAACCATCATAATACTCAAGCAAATCACCCTCTCACACAAGAAAATCATACAACAAACAATGATGTGGA
TAGTAACAATTCACAAACGAAAGCCTATTCTTATCATTACTCTCCTTATCTTAGAGTAAGCTCTCCTATT
GCAAGTGCAAGTTCAGGTTTTTATCATACTCCAAGAGTGGGAGATGAAGTATTAATAAGTTACTTAAATA
ATGACATAGATATGCCCATCATTATAGGCAGTCTCTACAATCCAAGTAATCCTGCCTTACCTCCCCTCCC
TTTAAATGCTCATCAAACAAGTTTAAGTGCAAGAACTCTTAATAATAGCAGTGCATTGCAAGCAGAGAAT
ACAAACTCTCATCACAATCTCATAGAATCTGGATTCAATGAAATCACGCTCTCCAATCTCAAAGAACAAG
AACACATCTATCTTCAAGCACAAAGAGATTATGAAGAACTCATTAAGCATAACTTTCTCCAAACCATACA
TAACAATAAAGAATCTCAAGTAGAGGGAACTTATAATGAAAGGATTAAAAAGATTCATACTCAAACCATA
GATTTAGCAAAGATTGTAAGTATTGGAGGAGAATATAATACCAATGTAGCTTTATCTAAAGATACCATTG
TAGGATTAAGTCATACTTTAAATGTAGGAGTAGATAACAAAGTAAGGATTGCAAAGAAGAGTAGTGAATA
TGTAGGAGAGGATAAGGAGGTGGAGATAGGGGGGAATCTCAATACAAGTATCAAACAAGATGAGAGTAGG
AATGTAGGGGGGAATAAGAGAGAGGTGGTGGAGGGGGACAGCGATATAAGCATTGAGAAAAAGTTTAATA
TTCAAACACAAGGTGAAATTGCTATTCATTCTAATGAGAATATTCATTTGTCATCTCCTCAATCTTTGAG
TTTAGAATCTGATAGAGCTGCTGTAATGGTTGCAGACAATATAACAATGATTGCAGATTCTAATTATCTC
CTTAATGCTAATAATGAAGCAACAATTCAAGTGAGCGATACTTCTATTGTAGCCAAAAGTGATTCTATCG
TTATTAAAGCTGGTGGAGTAGAAGTAGTCATAGATTCTAAAGGATTAGTCGTTAAAGGTGGGGAGGTAAA
GGCAGAGTGA