SecReT6
Effector Protein ID: 322835250
-
SecReT6 ID422
T6SS typeA2
Gene symbol-
Locus tagRahaq_4568
StrainRahnella sp. Y9602
Repliconplasmid pRAHAQ01 [GenBank: NC_015062] [Browse all T6SS(s) in this replicon]
Location [Strand]130359..130850 [+]
Producttype VI secretion system effector, Hcp1 family
Effector typeProtein
Homologous effectorEC042_4529
DescriptionHcp protein
UniProt IDE8Y0Y3
KEGG IDrah:Rahaq_4568
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.20E-37, Aligned region: 6..147
Protein Sequence: 163 a.a.     [Download]
>gi|322835250|ref|YP_004215276.1| type VI secretion system effector, Hcp1 family [Rahnella sp. Y9602]
MAIPVYLWLKDDGGADIKGSVDVKDREGSIEVVAQDHNLYIPTDNNTGKLTGTRIHTPFLFTKEIDSSSP
YLYKAVTTGQTLKSAEFKWYRINDAGQEVEYFNTKLENVKLVKVAPKMHDIKDPAKEKHNHLEAIELRYE
KITWTYKDGNIIHSDSWNERTTA
-
Nucleotide Sequence: 492 bp     [Download]
>gi|322835126|ref|NC_015062.1|:130359-130850 Rahnella sp. Y9602 plasmid pRAHAQ01, complete sequence
ATGGCAATTCCTGTTTATCTGTGGCTGAAAGACGACGGCGGTGCGGACATTAAAGGCTCCGTAGACGTTA
AAGATCGCGAAGGCAGCATCGAAGTGGTTGCACAGGATCACAACCTGTATATCCCGACCGATAACAACAC
CGGCAAACTGACGGGTACTCGTATTCACACCCCGTTCCTGTTTACCAAAGAAATCGATTCCTCCAGCCCG
TACCTGTACAAAGCGGTGACCACTGGCCAGACCCTTAAATCTGCTGAGTTCAAATGGTATCGCATCAATG
ACGCGGGCCAGGAAGTGGAGTATTTCAACACTAAACTCGAAAACGTCAAGCTGGTAAAAGTCGCGCCAAA
AATGCACGACATCAAAGATCCGGCTAAAGAGAAACACAACCACCTCGAAGCTATCGAGCTGCGTTACGAA
AAAATCACCTGGACCTACAAAGACGGCAACATCATTCATTCCGATTCCTGGAACGAACGTACTACCGCGT
AA