SecReT6
Effector Protein ID: 323529921
-
SecReT6 ID508
T6SS typeA4b
Gene symbol-
Locus tagBC1001_5639
StrainBurkholderia sp. CCGE1001
Repliconchromosome II [GenBank: NC_015137] [Browse all T6SS(s) in this replicon]
Location [Strand]2291772..2292275 [+]
Producttype VI secretion system effector, Hcp1 family
Effector typeProtein
Homologous effectorBCAL0343
DescriptionHcp protein
UniProt IDE8YV78
KEGG IDbug:BC1001_5639
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.30E-44, Aligned region: 5..140
Protein Sequence: 167 a.a.     [Download]
>gi|323529921|ref|YP_004232073.1| type VI secretion system effector, Hcp1 family [Burkholderia sp. CCGE1001]
MKDIYLKFGNPAIKGESADKDHAGWIEIDSWSHAITQPRSATASTAGGHTSERCEHADMVFTKDIDVVSP
LIYQHASGGTTFDEVTIDFMRSDGEGNRIKYLEVKLKYVIISSVTPSVVGEGLPSEQFSLKYAAVQWKYT
QQKIGGNQGGNAQGAWSLTKNDKTYAV
-
Nucleotide Sequence: 504 bp     [Download]
>gi|323527923|ref|NC_015137.1|:2291772-2292275 Burkholderia sp. CCGE1001 chromosome 2, complete sequence
ATGAAGGACATCTATTTAAAATTCGGCAATCCGGCGATCAAAGGCGAGTCCGCCGATAAGGATCACGCTG
GCTGGATCGAAATCGATTCGTGGAGCCACGCAATCACGCAACCGCGTTCGGCGACGGCATCCACCGCAGG
CGGCCACACGTCCGAGCGTTGCGAACACGCCGACATGGTGTTCACGAAAGACATCGACGTGGTGAGCCCG
CTGATTTATCAGCACGCCTCGGGCGGCACGACGTTCGACGAAGTCACGATCGACTTCATGCGTTCGGACG
GTGAAGGCAATCGCATCAAGTACCTCGAAGTGAAGCTCAAATACGTGATCATCTCGAGCGTCACGCCGAG
CGTCGTGGGCGAAGGTTTGCCGAGCGAGCAATTCTCGCTGAAGTACGCTGCCGTGCAGTGGAAGTACACG
CAGCAGAAGATCGGCGGCAATCAGGGCGGCAATGCGCAGGGCGCGTGGAGCCTGACGAAGAACGACAAGA
CCTACGCGGTGTAA