SecReT6
Effector Protein ID: 330809735
SecReT6 ID431
T6SS typeA4a
Gene symbol-
Locus tagPSEBR_a2892
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]3570658..3572883 [-]
Producthypothetical protein
Effector typeProtein
Homologous effectorPA0095
Descriptiontype VI secretion system Vgr family protein
UniProt IDF2KHI7
KEGG IDpba:PSEBR_a2892
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.50E-87, Aligned region: 30..329
Phage_base_V [PF04717], Evalue: 2.60E-26, Aligned region: 369..461
Gp5_C [PF06715], Evalue: 8.30E-25, Aligned region: 5..13
Gp5_C [PF06715], Evalue: 8.30E-25, Aligned region: 514..533
Gp5_C [PF06715], Evalue: 8.30E-25, Aligned region: 530..552
Gp5_C [PF06715], Evalue: 8.30E-25, Aligned region: 554..576
Gp5_C [PF06715], Evalue: 8.30E-25, Aligned region: 578..600
Gp5_C [PF06715], Evalue: 8.30E-25, Aligned region: 594..615
Gp5_C [PF06715], Evalue: 8.30E-25, Aligned region: 601..624
Gp5_C [PF06715], Evalue: 8.30E-25, Aligned region: 609..632
Gp5_C [PF06715], Evalue: 8.30E-25, Aligned region: 625..643
Gp5_C [PF06715], Evalue: 8.30E-25, Aligned region: 633..656
Gp5_C [PF06715], Evalue: 8.30E-25, Aligned region: 649..672
Gp5_C [PF06715], Evalue: 8.30E-25, Aligned region: 715..731
DUF2345 [PF10106], Evalue: 0.0047, Aligned region: 580..617
DUF2345 [PF10106], Evalue: 0.0047, Aligned region: 639..736
Protein Sequence: 741 a.a.     [Download]
>gi|330809735|ref|YP_004354197.1| hypothetical protein PSEBR_a2892 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MAITQNNRLVQVDSPLGGDVLLLQGMEGSEELGRLFHYELDLTSEDRAITFDQLLGKPMGLTLELYDGGK
RYFHGIVCSCRQLTGHGQFAGYRVSLRPWFWLLTRTSDCRIFQNKTVPDIIKQVFRDLGFSDFEDSLSGS
YREWEYCVQYRETSFDFVSRLMEQEGIYYYFRHEEARHVLVLADAYGAHSTAPDYASVPFYPPDRQMRER
DHFYDWQLAREVQPGSLALNDYDFLRPRASLEVRSSVPRNHTNADYPLYDYPGEYVQSNDGDHYARTRIE
AIHSQFERVQLRGRARGIGCGHVFTLTGYDRADQNREYLVVTARYQIRQDAYESGQSDVAEQFVSELDCM
DASQVFRPLPLTPMPIVRGPQTAVVVGPSGEEIWTDQYGRVKVHFHWDRHDQSNENSSCWIRVSQAWAGK
NWGSVQLPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYGLPANATQSGVKSRSSKGGSPANFNEIRM
EDKKGSEQLFIHAEKNQDIEVENDETHWVGHDRRKTIDNDETVHVKHDRTETVDNNETITIGVDRKEKVG
NNETISIGVNRTEDVGSNEKITIGANRTEKVGSNETITIGADRTEKVGANEKISIASNRTEDVGGNETIS
ISGNRNETVQGNEGIEINGNQSTQIGQNESRDVAQNRTTNINQNDSLDVGKHFSLTAGDSISLTTGAASI
TMKKDGTIVISGKNITIDGSGAIKIKANKNVVVKGQKILQN
-
Nucleotide Sequence: 2226 bp     [Download]
>ref|NC_015379.1|:c3572883-3570658 hypothetical protein PSEBR_a2892 [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGGCAATCACGCAAAACAACCGTTTGGTACAGGTCGACAGTCCTCTCGGCGGCGATGTCCTGTTGTTGC
AAGGCATGGAAGGCAGCGAAGAGTTGGGGCGGTTGTTCCACTACGAATTGGACCTGACCTCCGAAGACCG
GGCGATCACGTTCGACCAGCTGCTGGGCAAGCCAATGGGCCTGACCCTGGAACTGTATGACGGCGGCAAA
CGCTACTTCCACGGCATTGTCTGCAGTTGCCGGCAACTGACCGGCCACGGCCAATTCGCCGGTTATCGCG
TCAGCTTGCGCCCCTGGTTCTGGCTGCTCACGCGCACCTCCGATTGCCGGATTTTCCAGAACAAGACCGT
GCCGGACATCATCAAGCAGGTGTTCCGCGACCTCGGTTTCTCCGATTTCGAGGACAGCCTGAGCGGCAGC
TACCGCGAGTGGGAATATTGCGTGCAGTACCGCGAAACCAGCTTCGACTTCGTCAGTCGGCTGATGGAGC
AGGAAGGCATCTATTACTACTTTCGCCATGAAGAGGCGCGTCATGTGTTGGTGTTGGCCGACGCCTATGG
CGCCCACTCCACGGCGCCAGACTACGCCTCGGTGCCCTTCTATCCGCCTGATCGGCAAATGCGCGAGCGC
GATCATTTCTACGACTGGCAACTGGCACGGGAAGTCCAACCCGGTTCGCTGGCCCTGAACGACTATGACT
TCCTGCGCCCGCGCGCCAGTCTTGAGGTGCGCTCCAGCGTGCCGCGCAACCACACCAACGCCGACTACCC
GCTCTACGACTACCCGGGTGAATACGTCCAGAGCAACGATGGCGATCACTACGCGCGTACCCGCATCGAA
GCCATTCACAGCCAATTCGAGCGTGTGCAATTACGCGGTCGCGCCCGCGGAATCGGTTGCGGTCATGTGT
TCACGCTGACGGGATACGACCGTGCCGACCAGAACCGTGAATACCTGGTGGTGACCGCCCGTTATCAGAT
CCGTCAGGATGCCTATGAAAGCGGCCAGTCGGACGTCGCTGAACAGTTCGTCAGCGAGCTGGACTGCATG
GATGCCAGCCAAGTCTTCCGCCCTCTCCCCCTCACCCCCATGCCCATTGTTCGCGGGCCGCAGACTGCCG
TGGTGGTCGGCCCCAGTGGCGAGGAGATCTGGACCGACCAATATGGCCGGGTCAAAGTGCATTTCCACTG
GGATCGCCATGACCAGTCCAACGAAAACAGCTCCTGCTGGATTCGCGTGTCCCAGGCCTGGGCCGGCAAG
AACTGGGGATCCGTGCAGCTCCCGCGGATCGGTCAGGAAGTGATCGTCAGTTTCCTCGAGGGCGATCCGG
ATCGGCCGATTATCACTGGCCGCGTCTACAACGCTGAACAGACCGTGCCCTACGGATTGCCGGCCAATGC
CACCCAGAGCGGGGTGAAAAGTCGTTCAAGCAAGGGCGGTTCACCGGCCAACTTCAATGAAATCCGCATG
GAGGACAAGAAAGGCTCGGAGCAACTGTTTATCCACGCCGAGAAGAACCAGGACATCGAGGTCGAGAACG
ACGAAACCCACTGGGTCGGCCATGATCGCCGCAAGACCATCGACAACGACGAGACCGTGCATGTCAAACA
CGACCGCACCGAAACCGTCGATAACAACGAAACCATCACCATTGGTGTGGATCGCAAGGAAAAGGTCGGC
AATAACGAAACCATCTCCATCGGTGTGAACCGCACCGAGGATGTTGGCAGCAACGAGAAAATCACCATTG
GCGCCAATCGCACCGAGAAAGTGGGCAGTAACGAGACCATCACCATCGGCGCGGACCGCACGGAAAAAGT
CGGTGCCAACGAGAAAATCAGCATCGCCAGCAACCGCACCGAAGACGTGGGCGGCAACGAAACGATCAGC
ATCAGCGGCAACCGTAACGAAACGGTCCAGGGCAACGAAGGCATCGAGATCAACGGCAACCAGAGCACCC
AGATTGGCCAGAACGAATCCCGCGACGTCGCCCAGAATCGCACCACCAACATCAATCAGAACGACAGCCT
GGACGTGGGCAAGCATTTCTCCCTTACCGCCGGCGACTCCATCAGCCTGACCACGGGCGCGGCGAGCATC
ACCATGAAGAAGGACGGCACCATCGTGATCAGCGGCAAGAACATCACCATCGACGGCTCTGGCGCCATCA
AGATCAAGGCCAACAAAAACGTGGTCGTCAAAGGCCAGAAGATTCTGCAGAACTAG