SecReT6
Effector Protein ID: 330812639
-
SecReT6 ID432
T6SS typeA3
Gene symbol-
Locus tagPSEBR_a5567
StrainPseudomonas brassicacearum subsp. brassicacearum NFM421
Repliconchromosome [GenBank: NC_015379] [Browse all T6SS(s) in this replicon]
Location [Strand]6712142..6714079 [+]
Producttype VI secretion system, Vgr family
Effector typeProtein
Homologous effectorPA0091
Descriptiontype VI secretion system Vgr family protein
UniProt IDF2K720
KEGG IDpba:PSEBR_a5567
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.90E-89, Aligned region: 30..329
Phage_base_V [PF04717], Evalue: 7.80E-26, Aligned region: 369..462
Gp5_C [PF06715], Evalue: 0.0013, Aligned region: 514..536
Protein Sequence: 645 a.a.     [Download]
>gi|330812639|ref|YP_004357101.1| type VI secretion system, Vgr family [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
MLFNQASRLAKITSPLGPEVLLLKDMGGGEELGRLFNYELQLHSLDNAIDLNQVLGKPMCVSLQLDGGGE
RYFHGIVARFSQNVDQGQFASYQATLRPWFWLLTRTSDCRIFQNLTIPQIIKQVFRDLGFSDFEDALSRP
YREWEYCVQYRETSFDFVSRLMEQEGIYYFFRHEQGRHVLVLADAYGAHTTAPGYGSVPYYPKNEQQRER
DHIHDWHLAQEVQPGSLELNDYDFQRPSARIDVRSAMPRPHTAGDYPLYDYPGTYVQSQDGEHYARTRIE
ALQTQHEQVELAGNARGLGSGHLFSLTGFSRQDQNREYLIVGARYYLSQESGETGGGAPTAQFESSLTCI
DAQQSYRPLPITHRPIVKGPQTALVVGPKGEEIWTDQFGRVKVHFYWDRHDQSNENSSCWIRVSQAWAGK
NWGSMQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYDLPANATQSGMKSRSSKGGTPANFNEIRM
EDKKGAEQLYIHAERNQDIVVEVDESHSVGHDRNKSIGHNETVTIGNNRLRIVKQEDILSVGQRKTDSIS
QSYVIEVGENLRLVCGESILELNASGQINLTGVQISFYASGDAEFNTGGVLHLNNGGGPGATPDGQGVKG
SIDANIQAAFPAPKG
-
Nucleotide Sequence: 1938 bp     [Download]
>ref|NC_015379.1|:6712142-6714079 type VI secretion system, Vgr family [Pseudomonas brassicacearum subsp. brassicacearum NFM421]
ATGTTATTCAACCAAGCCTCACGCCTGGCCAAGATCACCAGCCCCCTGGGACCTGAGGTACTGCTGCTCA
AGGACATGGGCGGCGGCGAAGAACTGGGGCGGCTGTTCAACTATGAGTTGCAGCTGCACTCGCTGGATAA
CGCCATCGACCTCAATCAGGTGCTCGGCAAGCCCATGTGCGTGAGCCTGCAACTCGATGGCGGTGGCGAG
CGTTATTTCCATGGCATCGTGGCCCGTTTCAGCCAGAACGTCGACCAGGGCCAGTTCGCCAGTTACCAGG
CCACCCTGCGCCCGTGGTTTTGGCTGCTGACCCGTACCTCCGATTGCCGGATTTTCCAGAACCTCACCAT
CCCGCAGATCATCAAGCAGGTGTTCCGCGACTTGGGCTTTTCCGATTTCGAAGACGCCCTGAGCCGGCCT
TATCGCGAGTGGGAATACTGCGTGCAGTATCGCGAGACCAGTTTCGACTTCGTCAGCCGCTTGATGGAGC
AGGAAGGGATCTACTACTTCTTCCGCCATGAGCAAGGTCGACATGTGCTGGTGCTGGCCGACGCTTATGG
AGCCCACACCACGGCGCCCGGCTACGGCTCGGTGCCCTACTACCCCAAGAACGAGCAGCAGCGCGAGCGT
GACCACATACACGACTGGCACCTGGCCCAGGAAGTCCAGCCCGGCTCGCTGGAGCTCAACGACTACGACT
TCCAACGCCCCAGCGCACGCATCGACGTACGCTCGGCCATGCCCCGCCCACACACTGCCGGCGACTATCC
CCTGTACGACTACCCTGGCACCTACGTGCAGAGCCAGGACGGCGAACACTACGCCCGCACCCGCATCGAA
GCCTTGCAGACCCAGCACGAACAGGTCGAACTGGCCGGCAACGCCCGCGGCTTGGGTTCGGGGCACCTGT
TCAGCCTCACCGGCTTCAGCCGCCAGGACCAGAACCGCGAATACCTGATCGTCGGCGCCCGCTACTACCT
CTCCCAGGAAAGCGGCGAAACCGGCGGCGGCGCGCCGACAGCACAGTTCGAAAGCAGCCTGACCTGCATC
GACGCCCAGCAAAGCTATCGGCCGCTGCCCATCACCCATCGCCCTATCGTCAAGGGCCCGCAGACTGCCT
TAGTGGTGGGTCCCAAGGGCGAGGAAATCTGGACCGATCAGTTCGGCCGAGTGAAGGTGCACTTCTATTG
GGATCGGCACGACCAGTCCAACGAAAACAGCTCGTGCTGGATTCGCGTGTCGCAGGCATGGGCCGGGAAA
AACTGGGGCTCGATGCAGATCCCGCGCATTGGCCAGGAAGTGATCGTCAGTTTCCTCGAAGGCGACCCGG
ATCGGCCGATCATCACCGGTCGCGTCTACAATGCCGAACAGACCGTGCCCTATGACTTGCCCGCCAATGC
CACCCAGAGCGGGATGAAAAGCCGTTCGAGCAAGGGCGGCACGCCGGCGAATTTCAACGAAATCCGCATG
GAAGACAAGAAAGGCGCCGAGCAACTGTACATCCACGCCGAGCGTAACCAGGACATCGTGGTCGAGGTGG
ATGAAAGCCACTCGGTGGGCCACGACCGCAACAAGAGCATCGGCCACAACGAGACGGTGACCATCGGCAA
CAACCGCCTGCGCATCGTCAAGCAGGAGGACATCCTCTCCGTCGGCCAGCGCAAGACCGACAGCATCAGC
CAGAGCTACGTGATTGAAGTGGGCGAAAACCTGCGCCTGGTGTGCGGCGAAAGCATCCTGGAGCTCAACG
CCAGCGGCCAGATCAACCTGACCGGCGTACAGATCAGCTTCTACGCCAGCGGCGATGCCGAGTTCAACAC
CGGCGGCGTGCTGCACCTGAACAACGGCGGCGGCCCCGGAGCCACGCCGGACGGCCAGGGCGTCAAGGGC
AGCATCGATGCCAACATCCAAGCCGCGTTCCCTGCACCCAAGGGCTAA